DGVVSALSLRERIREHLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLQE
SVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSETDRLLAKLAYMRSGLGCDVIILDHISI
VVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQMP
NLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY
The query sequence (length=276) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6n9x:B | 500 | 279 | 0.9819 | 0.5420 | 0.9713 | 0.0 | 1e0j:A, 1e0j:B, 1e0j:C, 1e0j:D, 1e0j:E, 1e0j:F, 6n7i:A, 6n7i:B, 6n7i:C, 6n7i:D, 6n7i:E, 6n7n:A, 6n7n:B, 6n7n:C, 6n7n:D, 6n7n:E, 6n7n:F, 6n7s:A, 6n7s:B, 6n7s:C, 6n7s:D, 6n7s:E, 6n7t:A, 6n7t:B, 6n7t:C, 6n7t:D, 6n7t:E, 6n7t:F, 6n7v:A, 6n7v:B, 6n7v:C, 6n7v:D, 6n7v:E, 6n7v:F, 6n9u:E, 6n9v:A, 6n9v:B, 6n9v:C, 6n9v:D, 6n9v:E, 6n9v:F, 6n9w:A, 6n9w:B, 6n9w:C, 6n9w:D, 6n9w:E, 6n9x:A, 6n9x:C, 6n9x:D, 6n9x:E |
2 | 1cr1:A | 245 | 274 | 0.8587 | 0.9673 | 0.8650 | 8.76e-163 | 1cr2:A, 1cr4:A |
3 | 8a3v:A | 450 | 229 | 0.2065 | 0.1267 | 0.2489 | 4.96e-08 | 8a3v:B, 6t66:A, 6t66:B, 6t66:C, 6t66:D, 6t66:E, 6t66:F |
4 | 6bbm:A | 405 | 235 | 0.2174 | 0.1481 | 0.2553 | 2.42e-07 | |
5 | 6bbm:D | 455 | 235 | 0.2174 | 0.1319 | 0.2553 | 3.18e-07 | 6bbm:F, 6bbm:B, 6bbm:C, 6bbm:E, 6qel:A, 6qel:B, 6qel:C, 6qel:D, 6qel:E, 6qel:F, 6qem:A, 6qem:B, 6qem:C, 6qem:D, 6qem:E, 6qem:F, 7t20:B, 7t20:C, 7t20:E, 7t20:F, 7t20:D, 7t21:A, 7t21:B, 7t21:C, 7t21:D, 7t21:E, 7t21:F, 7t22:A, 7t22:B, 7t22:C, 7t22:D, 7t22:E, 7t22:F, 7t23:A, 7t23:B, 7t23:C, 7t23:D, 7t23:E, 7t23:F |
6 | 8e2l:C | 461 | 279 | 0.2246 | 0.1345 | 0.2222 | 3.80e-07 | 8e2l:A, 8e2l:B, 8e2l:D, 8e2l:E, 8e2l:F |
7 | 4esv:C | 434 | 221 | 0.1667 | 0.1060 | 0.2081 | 9.03e-05 | 4esv:A, 4esv:B, 4esv:D, 4esv:E, 4esv:F, 4esv:G, 4esv:H, 4esv:I, 4esv:J, 4esv:K, 4esv:L, 2vye:A, 2vye:B |
8 | 5lkm:A | 390 | 227 | 0.1812 | 0.1282 | 0.2203 | 0.11 | 5lkm:C |
9 | 3fvq:B | 350 | 44 | 0.0580 | 0.0457 | 0.3636 | 0.94 | 3fvq:A |
10 | 8i6r:B | 222 | 34 | 0.0471 | 0.0586 | 0.3824 | 1.4 | 8i6r:D, 8i6s:B, 8i6s:D |
11 | 7sjk:A | 266 | 49 | 0.0471 | 0.0489 | 0.2653 | 1.9 | 7sjk:B, 7sp2:A |
12 | 3c41:J | 242 | 30 | 0.0580 | 0.0661 | 0.5333 | 2.4 | 3c41:K, 3c4j:A, 3c4j:B, 2olj:A, 2olj:B, 2olk:A, 2olk:B, 2olk:C, 2olk:D, 2q0h:A, 2q0h:B |
13 | 5ub4:B | 279 | 123 | 0.1196 | 0.1183 | 0.2683 | 3.3 | 5ub4:A, 5ub6:A, 5ub6:B, 5ub7:A, 5ub7:B |
14 | 6nak:D | 165 | 25 | 0.0399 | 0.0667 | 0.4400 | 4.0 | 6n9a:E, 6nak:E, 6s84:E, 6s84:B |
15 | 6z4w:A | 230 | 34 | 0.0435 | 0.0522 | 0.3529 | 4.0 | 6z63:A, 6z63:B, 6z63:C, 6z67:C, 6z67:B, 6z67:E |
16 | 7wbt:A | 899 | 31 | 0.0362 | 0.0111 | 0.3226 | 4.1 | 7wbt:B, 7wbu:A |
17 | 3fjo:A | 603 | 89 | 0.0761 | 0.0348 | 0.2360 | 4.2 | 3qfs:A, 3qft:A |
18 | 4ak2:A | 286 | 57 | 0.0725 | 0.0699 | 0.3509 | 5.2 | |
19 | 1ewq:A | 759 | 22 | 0.0399 | 0.0145 | 0.5000 | 8.2 | 1ewq:B, 1fw6:A, 1fw6:B, 1nne:A, 1nne:B |
20 | 3bk7:A | 593 | 24 | 0.0435 | 0.0202 | 0.5000 | 8.3 | 3j15:B, 5lw7:B, 1yqt:A, 5yv5:A |
21 | 6r84:A | 446 | 44 | 0.0652 | 0.0404 | 0.4091 | 8.5 | |
22 | 5ubv:A | 244 | 59 | 0.0580 | 0.0656 | 0.2712 | 8.8 | 5ubv:B |
23 | 7kya:A | 1174 | 40 | 0.0580 | 0.0136 | 0.4000 | 9.9 | 7ky5:A, 7ky7:A, 7ky8:A, 7ky9:A |
24 | 4v7e:Cf | 111 | 79 | 0.0652 | 0.1622 | 0.2278 | 10.0 | 8jiv:Cf, 4v3p:Lj |