BioLiP

>protein
DGAIWQWRDDRGLWHPYNRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPLAN

The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	9bkr:A	74	74	1.0000	1.0000	1.0000	1.97e-51	9bks:A, 8tre:A, 7uw7:A
2	7mop:A	2445	62	0.3108	0.0094	0.3710	4.16e-10	6fyh:A, 6pfl:A, 6pfl:B, 8r7o:A, 8r7o:C, 8rd0:C, 8rd0:D, 8rd1:A, 8rd1:C, 8rd1:D, 8rd7:D, 6xz1:A
3	8r5n:A	165	58	0.2973	0.1333	0.3793	6.41e-08	8r5n:B, 8r6a:A, 8r6a:B, 8r6b:A
4	8r5n:A	165	71	0.3243	0.1455	0.3380	2.06e-06	8r5n:B, 8r6a:A, 8r6a:B, 8r6b:A
5	7kzh:A	182	71	0.2568	0.1044	0.2676	0.001	7tgq:A
6	3ujk:A	298	29	0.1486	0.0369	0.3793	0.75	3nmv:B, 3ujl:B
7	1gpm:A	501	33	0.1622	0.0240	0.3636	3.1	1gpm:B, 1gpm:C, 1gpm:D
8	2d7i:A	536	38	0.1351	0.0187	0.2632	3.4	2d7r:A
9	4v8p:BC	409	28	0.1486	0.0269	0.3929	4.8	4v8p:CC, 4v8p:EC, 4v8p:GC
10	7qzj:A	422	22	0.1486	0.0261	0.5000	5.7	7qzj:B
11	6z1p:AN	96	40	0.1622	0.1250	0.3000	5.9
12	3lnn:A	341	42	0.2027	0.0440	0.3571	6.1
13	8wmi:A	1237	22	0.1216	0.0073	0.4091	8.5
14	8wmc:A	1249	22	0.1216	0.0072	0.4091	8.8
15	8wm4:A	1331	22	0.1216	0.0068	0.4091	8.8
16	7y9x:A	1458	22	0.1216	0.0062	0.4091	8.8	8gs2:A
17	8d1v:A	1229	22	0.1216	0.0073	0.4091	9.2
18	8eex:A	1284	22	0.1216	0.0070	0.4091	9.2
19	7wah:A	1473	22	0.1216	0.0061	0.4091	9.3
20	7y9y:A	1482	22	0.1216	0.0061	0.4091	9.3	8wml:A
21	7yn9:A	1514	22	0.1216	0.0059	0.4091	9.8
22	8eey:A	1544	22	0.1216	0.0058	0.4091	9.8	7yna:A, 7ynb:A, 7ync:A

[Back]