BioLiP

>protein
DFYKLDEKLKELKRKRVDVSIKSRKLADREIQEVSEKAFHYTVQEYDAWERRISYDQLAKLSYEKTLRNLATQTKVQKDT
KTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNINDKNKQFNEKLSRES

The query sequence (length=134) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7b9v:y	134	134	1.0000	1.0000	1.0000	6.27e-93	6exn:y, 5mps:y, 5mq0:y
2	5gm6:f	102	99	0.6119	0.8039	0.8283	7.83e-47	6bk8:R, 5gmk:I, 6j6g:I, 6j6h:I, 6j6n:I, 6j6q:I, 5wsg:I, 5y88:K, 5ylz:K
3	8e73:G2	258	46	0.1343	0.0698	0.3913	0.84	6x89:G2
4	7nhn:d	204	84	0.1866	0.1225	0.2976	1.3	8uu4:c, 8uu5:c, 8uu6:c, 8uu7:c, 8uu8:c, 8uu9:c
5	6qm5:A	673	34	0.0896	0.0178	0.3529	5.4	6qm5:B, 6qm9:A, 6qm9:B, 6qma:A, 6qma:B, 6qmb:A, 6qmb:B, 8toi:A, 8toi:B, 8tok:A, 8tok:B, 8tol:A, 8tol:B, 4wis:A, 4wis:B, 4wit:A, 4wit:B
6	8a3y:A	1426	78	0.1716	0.0161	0.2949	6.7	8oeu:A, 8oev:A, 8oew:A, 8of0:A, 7okx:A, 7oky:A, 7ol0:A, 7pks:A, 8rbx:A, 6ted:A, 8uhg:A, 8ui0:A, 7unc:A, 7und:A
7	7jgh:A	1421	40	0.0896	0.0084	0.3000	8.6
8	8i0u:R	380	27	0.0896	0.0316	0.4444	9.0	8c6j:K, 8i0s:R, 8i0t:R, 8i0v:R, 8i0w:R, 6icz:R, 6id0:R, 6id1:R, 5mqf:C, 6qdv:K, 7w59:R, 7w5a:R, 7w5b:R, 5xjc:R, 5yzg:R, 6zym:C
9	9fmd:R	328	27	0.0896	0.0366	0.4444	9.3	8ro2:R

[Back]