DFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRK
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3rdv:D | 72 | 71 | 1.0000 | 0.9861 | 1.0000 | 2.72e-48 | 3rdv:A, 3rdv:B, 3rdv:C |
2 | 2e4h:A | 74 | 70 | 0.5493 | 0.5270 | 0.5571 | 3.43e-26 | |
3 | 2hl3:A | 76 | 68 | 0.4648 | 0.4342 | 0.4853 | 2.17e-17 | 3e2u:A, 3e2u:D, 3e2u:B, 3e2u:C, 2hqh:A, 2hqh:B, 2hqh:C, 2hqh:D |
4 | 6fc6:A | 83 | 55 | 0.3099 | 0.2651 | 0.4000 | 2.39e-06 | |
5 | 4n67:A | 214 | 42 | 0.1831 | 0.0607 | 0.3095 | 1.1 | |
6 | 4pz2:B | 494 | 47 | 0.2535 | 0.0364 | 0.3830 | 1.7 | 4pz2:A, 4pz2:C, 4pz2:D |
7 | 8wnf:A | 918 | 40 | 0.1972 | 0.0153 | 0.3500 | 2.0 | 8wng:A, 8wni:A, 8wnj:A, 8wo2:A, 8wo3:A |
8 | 3tu6:A | 127 | 50 | 0.1972 | 0.1102 | 0.2800 | 3.4 | |
9 | 3rsj:A | 406 | 55 | 0.2394 | 0.0419 | 0.3091 | 4.2 | 3rsj:B, 3rsj:C, 3rsj:D |
10 | 8vd8:A | 466 | 25 | 0.1408 | 0.0215 | 0.4000 | 5.5 | 8vdc:A |
11 | 2f3m:A | 218 | 18 | 0.1268 | 0.0413 | 0.5000 | 6.2 | 2f3m:B, 2f3m:C, 2f3m:D, 2f3m:E, 2f3m:F, 1xw6:A, 1xw6:B, 1xw6:C, 1xw6:D, 1xwk:A, 1xwk:B, 1xwk:C, 1yj6:A, 1yj6:B, 1yj6:C |
12 | 5dt6:A | 266 | 14 | 0.1127 | 0.0301 | 0.5714 | 9.8 | 5ict:A |