DFLSNFLTDFVGQLQSPTLAFLIGGMVIAALGTQLVIPEAISTIIVFMLLTKIGLTGGMAIRNSNLTEMLLPVAFSVILG
ILIVFIARFTLAKLPNVRTVDALATGGLFGAVSGSTMAAALTTLEESKISYEAWAGALYPFMDIPALVTAIVVANIYLNK
RKRRVKIWPIIEESLQGPALSAMLLGLALGIFTKPESVYEGFYDPLFRGLLSILMLIMGMEAWSRIGELRKVAQWYVVYS
LIAPIVHGFIAFGLGMIAHYATGFSLGGVVVLAVIAASSSDISGPPTLRAGIPSANPSAYIGSSTAIGTPIAIGVCIPLF
IGLAQTLGAG
The query sequence (length=330) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7egl:A | 335 | 335 | 1.0000 | 0.9851 | 0.9851 | 0.0 | 7egk:A, 7egk:C, 7egk:E |
2 | 4x4j:A | 482 | 60 | 0.0606 | 0.0415 | 0.3333 | 4.0 | 4x4j:B |
3 | 5kxq:A | 327 | 31 | 0.0333 | 0.0336 | 0.3548 | 8.2 | 5kxq:B, 5kxq:C, 5kxq:D |
4 | 7tbj:A5 | 1276 | 31 | 0.0455 | 0.0118 | 0.4839 | 8.6 | 5hax:A, 5hb0:B, 5hb0:C, 5hb0:A, 7tbi:A1, 7tbi:A2, 7tbi:A3, 7tbi:A4, 7tbj:A1, 7tbj:A3, 7tbj:A6, 7tbk:A1, 7tbk:A3, 7tbk:A5, 7tbk:A6, 7tbl:A1, 7tbl:A3, 7tbl:A5, 7tbl:A6, 7tbm:A1, 7tbm:A3, 7tbm:A5, 7tbm:A6 |
5 | 7tbj:A2 | 1269 | 31 | 0.0455 | 0.0118 | 0.4839 | 8.8 | 7tbj:A4, 7tbk:A2, 7tbk:A4, 7tbl:A2, 7tbl:A4, 7tbm:A2, 7tbm:A4 |