DFIYDDRPAAVSSTFNPEKGYMDFITAYGKNINADNVRIFFLNHKKAKDSLKGSPKVEVDLQFGTLRVKVVNNHNPRNRD
NPVADNAITLHRLSGYLAKWCFDEIDHGQIEEAEVKSKVVIPLAEAKGCKWGDGVALYLAFAPGAEMFLKDFEFYPLAID
IQRVVKDGMDITFMRKVLKQRYGTKTADDWMISEVTAIQSAVKVVAKLPWAKAGFTAAAKNFLAKFNISV
The query sequence (length=230) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4j1j:C | 234 | 230 | 1.0000 | 0.9829 | 1.0000 | 6.30e-173 | 4j1g:A, 4j1g:D, 4j1g:C, 4j1g:B, 4j1j:A, 4j1j:B, 4j1j:D |
2 | 4jng:A | 226 | 226 | 0.5217 | 0.5310 | 0.5310 | 2.07e-90 | 4jng:B, 4jng:C, 4jng:D |
3 | 4bhh:F | 232 | 230 | 0.4391 | 0.4353 | 0.4391 | 6.48e-69 | 4bhh:B, 4bhh:D, 4bhh:Z |
4 | 4ijs:A | 232 | 228 | 0.4087 | 0.4052 | 0.4123 | 1.01e-62 | 4ijs:B, 4ijs:C, 4ijs:D, 3zla:A, 3zla:B, 3zla:C, 3zla:D, 3zla:E, 3zla:F, 3zla:G, 3zla:H |
5 | 8ayz:A | 278 | 28 | 0.0609 | 0.0504 | 0.5000 | 3.3 | 1eah:1, 3epf:1 |
6 | 4ue0:B | 115 | 28 | 0.0565 | 0.1130 | 0.4643 | 3.5 | |
7 | 5b7i:A | 1044 | 40 | 0.0478 | 0.0105 | 0.2750 | 4.1 | |
8 | 1po1:1 | 283 | 53 | 0.0739 | 0.0601 | 0.3208 | 4.2 | 1po2:1, 1vbd:1 |
9 | 6f6t:B | 677 | 57 | 0.0565 | 0.0192 | 0.2281 | 6.5 | 6f6t:A, 6hqf:A, 6hqf:B |
10 | 6ici:A | 585 | 65 | 0.0696 | 0.0274 | 0.2462 | 9.9 |