BioLiP

>protein
DFETDESVLMRRQKQINYGKNTIAYDRYIKEVPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDP

The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4qoz:C	73	73	1.0000	0.9178	0.9178	9.06e-44	4l8r:C
2	4tuw:A	71	67	0.5522	0.5211	0.5522	1.10e-23	4tuw:B, 4tux:B, 4tux:A
3	4tv0:A	47	60	0.4030	0.5745	0.4500	2.07e-12
4	5fix:A	624	47	0.2388	0.0256	0.3404	0.19	5fix:B, 6fje:B, 6fje:A, 6fjg:A, 6fjg:B, 5fk7:A, 5fk7:B, 5fk8:A, 5fk8:B, 5fkb:A, 5fkb:B, 5fkc:A, 5fkc:B, 5fmb:A, 5fmb:B, 5fmc:A, 5fmc:B, 5fmd:A, 5fmd:B, 5nsl:A, 5nsl:B, 5o47:B, 5o47:A, 6s2g:A, 6s2g:B, 6s2h:A, 6s2h:B, 6s3z:A, 6s3z:B, 6s82:A, 6s82:B
5	3afg:B	507	17	0.1493	0.0197	0.5882	0.36	3afg:A
6	7f0d:E	207	40	0.1493	0.0483	0.2500	1.7	7kgb:E, 7msc:E, 7msh:E, 7msm:E, 7msz:E, 7mt2:E, 7mt3:E, 7mt7:E, 7sfr:E, 5v7q:E, 5v93:E
7	6ome:A	499	20	0.1493	0.0200	0.5000	1.7
8	4c2u:A	658	37	0.2090	0.0213	0.3784	2.4	4c2t:A, 4c2t:B, 4c2t:C, 4c2t:D, 4c2u:D, 4c30:I, 4c30:D
9	4c30:F	632	37	0.2090	0.0222	0.3784	2.5	4c30:A
10	1e3d:B	537	32	0.1642	0.0205	0.3438	5.9	1e3d:D
11	4pz0:A	321	22	0.1493	0.0312	0.4545	6.1
12	4a7x:C	234	45	0.2537	0.0726	0.3778	7.4	4a7w:A, 4a7w:B, 4a7x:B, 4a7x:D, 4a7x:E

[Back]