DEEFKFLATEAKMLITAAERLAGTDPELQEMVALIKKELEQAERTFRNGDKSEAQRQLEFVLTAARAVMNVAAAANAAGT
DPELIEMVLRILKQLKEAIRTFQNGDQEEAETQLRFVLRAAIAVAVVAAALVLAGTDPELQEMVKQILEELKQAIETFAR
GDKEKALTQLLFVAWAAHAVAMIAAAANLAGTDPRLQQQVKEILEKLKEAIETFQKGDEEQAFRQLAEVLAEAALVALRA
AL
The query sequence (length=242) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7uni:B | 245 | 242 | 1.0000 | 0.9878 | 1.0000 | 2.98e-167 | 7uni:A, 7uni:C, 7uni:D |
2 | 7ue2:A | 304 | 218 | 0.2769 | 0.2204 | 0.3073 | 0.33 | |
3 | 2f1k:A | 279 | 51 | 0.0702 | 0.0609 | 0.3333 | 0.52 | 2f1k:B, 2f1k:C, 2f1k:D |
4 | 4arz:A | 291 | 109 | 0.1074 | 0.0893 | 0.2385 | 4.6 | 6jwp:A, 6jwp:F, 3r7w:A, 3r7w:C |
5 | 7q4g:C | 231 | 48 | 0.0702 | 0.0736 | 0.3542 | 5.0 | 7q4f:A, 7q4f:B, 7q4f:C, 7q4f:D, 7q4f:E, 7q4g:A, 7q4g:B, 7q4g:D, 7q4g:E, 6xub:A, 6xub:B, 6xub:C, 6xub:D, 6xub:E, 6xuc:A, 6xuc:B, 6xuc:C, 6xuc:D, 6xuc:E |
6 | 7khs:C | 427 | 45 | 0.0579 | 0.0328 | 0.3111 | 9.7 | |
7 | 8fit:A | 229 | 113 | 0.1529 | 0.1616 | 0.3274 | 9.7 | 8fit:C |
8 | 2m0u:A | 117 | 53 | 0.0826 | 0.1709 | 0.3774 | 9.8 |