DDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGMDLLLMDDFKLV
INDLTYHVRPPKRDL
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6k7x:C | 276 | 95 | 0.9789 | 0.3370 | 0.9789 | 1.88e-63 | 6k7x:A, 6k7x:B, 6k7x:D, 6k7x:K, 6k7x:L, 6k7x:M, 6k7x:N, 6k7y:A, 6k7y:B, 6k7y:C, 6k7y:D, 6k7y:N, 6k7y:O, 6k7y:P, 6k7y:Q, 5kue:A |
2 | 8bwy:C | 4264 | 54 | 0.1789 | 0.0040 | 0.3148 | 2.0 | |
3 | 6zyw:C | 4433 | 54 | 0.1789 | 0.0038 | 0.3148 | 2.1 | |
4 | 8bx8:A | 4453 | 54 | 0.1789 | 0.0038 | 0.3148 | 2.1 | 7k58:A, 7k5b:A, 7kek:A |
5 | 7moq:C | 4159 | 54 | 0.1789 | 0.0041 | 0.3148 | 2.2 | 6zyy:C |
6 | 6l6r:A | 610 | 28 | 0.1053 | 0.0164 | 0.3571 | 3.6 | 6l6r:B, 7nam:A, 3sob:B, 3soq:A, 3sov:A |
7 | 6xyw:Bg | 128 | 43 | 0.1579 | 0.1172 | 0.3488 | 3.6 | |
8 | 8cwr:A | 85 | 30 | 0.1263 | 0.1412 | 0.4000 | 5.9 | 8cwt:A, 8cwt:C, 8cwt:E, 8cyf:A |
9 | 5jbd:B | 855 | 38 | 0.1368 | 0.0152 | 0.3421 | 7.9 | 5jbd:A, 5jbe:A, 5jbe:B, 5jbf:A, 5jbf:B |
10 | 6xu2:A | 1091 | 18 | 0.1263 | 0.0110 | 0.6667 | 8.2 | 6xte:A |