DDQVFEAVGTTDELSSAIGFALELVTGHTFAEELQKIQCTLQDVGSALATYTTFKAGPILELEQWIDKYTSQLPPLTAFI
LPGGKISSALHFCRAVCRRAKRRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYM
The query sequence (length=147) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7rut:E | 187 | 154 | 0.9796 | 0.7701 | 0.9351 | 3.81e-99 | 6d5k:A, 6d5k:C, 6d5k:B, 6d5x:A, 6d5x:C, 6d5x:B, 2idx:A, 2idx:C, 2idx:B, 7rut:D, 7rut:C, 7rut:F, 7rut:B, 7rut:A, 7ruu:A, 7ruu:C, 7ruu:B, 7ruu:D, 7ruv:A, 7ruv:D, 7ruv:B, 7ruv:C |
2 | 3ci1:A | 188 | 157 | 0.4286 | 0.3351 | 0.4013 | 3.51e-30 | 3ci3:A, 3ci4:A, 3gah:A, 3gai:A, 3gaj:A, 2nt8:A, 2r6t:A, 2r6t:B, 2r6x:A, 2r6x:B |
3 | 3ke5:A | 182 | 142 | 0.4082 | 0.3297 | 0.4225 | 7.30e-27 | 3ke5:C, 3ke5:B |
4 | 2zhz:B | 174 | 149 | 0.3878 | 0.3276 | 0.3826 | 2.30e-26 | 2zhz:A, 2zhz:C |
5 | 8d32:A | 186 | 114 | 0.3265 | 0.2581 | 0.4211 | 5.71e-16 | 6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C |
6 | 8joz:A | 257 | 60 | 0.1429 | 0.0817 | 0.3500 | 2.3 | 4htf:A, 4htf:B |