BioLiP

>protein
DDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATKYFKAGPILELEQWIDKYTSQLPPLTAF
ILPSGGKISSALHFCRAVCCRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIY

The query sequence (length=148) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7rut:E	187	153	0.9865	0.7807	0.9542	9.00e-105	6d5k:A, 6d5k:C, 6d5k:B, 6d5x:A, 6d5x:C, 6d5x:B, 2idx:A, 2idx:C, 2idx:B, 7rut:D, 7rut:C, 7rut:F, 7rut:B, 7rut:A, 7ruu:A, 7ruu:C, 7ruu:B, 7ruu:D, 7ruv:A, 7ruv:D, 7ruv:B, 7ruv:C
2	3ci1:A	188	157	0.3986	0.3138	0.3758	1.13e-30	3ci3:A, 3ci4:A, 3gah:A, 3gai:A, 3gaj:A, 2nt8:A, 2r6t:A, 2r6t:B, 2r6x:A, 2r6x:B
3	3ke5:A	182	144	0.3919	0.3187	0.4028	9.27e-25	3ke5:C, 3ke5:B
4	2zhz:B	174	152	0.3784	0.3218	0.3684	1.10e-23	2zhz:A, 2zhz:C
5	8d32:A	186	118	0.3176	0.2527	0.3983	2.20e-16	6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C
6	6rxs:A	218	56	0.1284	0.0872	0.3393	0.96
7	6rxj:A	235	56	0.1284	0.0809	0.3393	1.1	6rxj:B, 6rxk:A, 6rxl:A, 6rxm:A, 6rxm:B, 6rxm:C, 6rxm:D, 6rxm:E, 6rxm:F, 6rxo:A, 6rxo:B, 6rxp:A, 6rxp:B, 6rxq:A, 6rxq:B, 6rxq:C, 6rxq:D, 6rxr:A, 6rxr:B, 6rxr:C, 6rxr:D, 1s5p:A
8	8h0s:C	190	133	0.2230	0.1737	0.2481	3.3	8h0s:A, 8h0t:A, 4poo:A
9	3b55:A	408	60	0.1419	0.0515	0.3500	3.7
10	7kq8:A	294	66	0.1216	0.0612	0.2727	4.0	7kq8:B, 7kq8:C, 7kq8:D, 7l5c:A, 7l5c:B, 7l5c:C, 7m8h:A, 7m8h:B, 7m8h:C, 7m8h:D
11	8h0s:B	171	78	0.1486	0.1287	0.2821	7.3	8h0s:D, 4poo:B
12	2eo5:A	412	33	0.0878	0.0316	0.3939	8.8
13	3wqy:A	905	85	0.1622	0.0265	0.2824	8.9	3wqy:B, 3wqz:A, 3wqz:B, 2ztg:A

[Back]