DDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATFKAGPILELEQWIDKYTSQLPPLTAFIL
PSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMK
The query sequence (length=148) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7rut:E | 187 | 155 | 0.9932 | 0.7861 | 0.9484 | 7.64e-105 | 6d5k:A, 6d5k:C, 6d5k:B, 6d5x:A, 6d5x:C, 6d5x:B, 2idx:A, 2idx:C, 2idx:B, 7rut:D, 7rut:C, 7rut:F, 7rut:B, 7rut:A, 7ruu:A, 7ruu:C, 7ruu:B, 7ruu:D, 7ruv:A, 7ruv:D, 7ruv:B, 7ruv:C |
2 | 3ci1:A | 188 | 157 | 0.4122 | 0.3245 | 0.3885 | 7.35e-31 | 3ci3:A, 3ci4:A, 3gah:A, 3gai:A, 3gaj:A, 2nt8:A, 2r6t:A, 2r6t:B, 2r6x:A, 2r6x:B |
3 | 3ke5:A | 182 | 144 | 0.3986 | 0.3242 | 0.4097 | 1.91e-26 | 3ke5:C, 3ke5:B |
4 | 2zhz:B | 174 | 152 | 0.3851 | 0.3276 | 0.3750 | 4.00e-25 | 2zhz:A, 2zhz:C |
5 | 8d32:A | 186 | 122 | 0.3243 | 0.2581 | 0.3934 | 2.15e-17 | 6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C |
6 | 8h0s:C | 190 | 126 | 0.2027 | 0.1579 | 0.2381 | 4.8 | 8h0s:A, 8h0t:A, 4poo:A |
7 | 7n6e:I | 199 | 64 | 0.1014 | 0.0754 | 0.2344 | 5.3 | 7n6e:G, 7pbe:D, 7pbe:I, 3sjv:D, 3sjv:I, 3sjv:N, 3sjv:S, 8ye4:G, 8ye4:I |