BioLiP

>protein
DDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGFGSYISEVK
EVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQ

The query sequence (length=135) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1jfi:B	135	135	1.0000	1.0000	1.0000	3.11e-96
2	4awl:B	92	85	0.2444	0.3587	0.3882	2.86e-17	7ah8:A, 7ah8:C, 6qmp:B, 6qmq:B, 6qms:B, 8qu2:B, 8qu3:B, 8qu4:B
3	4wzs:B	113	121	0.3185	0.3805	0.3554	3.44e-16
4	6r2v:B	93	84	0.2148	0.3118	0.3452	1.02e-15	7cvo:B, 7cvq:B, 7cvq:G, 7cvq:L, 7cvq:Q
5	7c9o:B	85	83	0.2000	0.3176	0.3253	8.10e-15
6	7aw7:B	92	83	0.2296	0.3370	0.3735	5.24e-14	7aw9:B, 4g91:B, 4g92:B, 6y35:B, 6y36:B, 6y37:B, 6y39:B, 6y39:E, 6y39:H
7	7r5s:W	88	61	0.1259	0.1932	0.2787	0.034	7ywx:W
8	1a7w:A	68	61	0.1407	0.2794	0.3115	0.035	5t5k:A, 5t5k:B, 5t5k:C, 5t5k:D, 5t5k:E, 5t5k:F
9	3u52:D	328	64	0.1111	0.0457	0.2344	0.069	3u52:C
10	4lgd:A	350	48	0.1407	0.0543	0.3958	0.53	8a5j:A, 8a66:A, 8a66:B, 6ao5:A, 5dh3:A, 5dh3:B, 4lgd:B, 4lgd:C, 4lgd:D, 8pav:A, 8pav:B, 8paw:A, 8paw:B, 6yat:A, 6yat:B
11	6yuf:C	456	50	0.1407	0.0417	0.3800	1.3
12	5mko:A	308	62	0.1333	0.0584	0.2903	4.2	5mko:B, 5mkp:A, 5mkq:A, 5mkq:B, 3vrh:A
13	6bxi:A	333	53	0.1259	0.0511	0.3208	4.3	6bxi:B
14	7d69:C	95	68	0.1259	0.1789	0.2500	7.0	7d69:G
15	8des:A	475	37	0.1037	0.0295	0.3784	8.9

[Back]