DDKVKKEVGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYPCGECSYHFVKLIEKYPVQTSSRTAAAMWGCHIH
NKVNEYLKKDIYDCATILEDYDCGCS
The query sequence (length=106) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1jra:A | 106 | 106 | 1.0000 | 1.0000 | 1.0000 | 9.53e-78 | 1jr8:A, 1jr8:B, 1jra:B, 1jra:C, 1jra:D |
2 | 1oqc:A | 112 | 100 | 0.3585 | 0.3393 | 0.3800 | 1.72e-25 | 1oqc:B, 1oqc:C, 1oqc:D, 3r7c:A, 3r7c:B, 3r7c:C, 3r7c:D |
3 | 2hj3:A | 101 | 94 | 0.3019 | 0.3168 | 0.3404 | 6.04e-24 | 2hj3:B |
4 | 3tk0:A | 126 | 100 | 0.3679 | 0.3095 | 0.3900 | 1.25e-23 | 4ldk:A, 3mbg:A, 3mbg:B, 3mbg:C, 3o55:A, 3u2l:A, 3u2m:A, 3u5s:A |
5 | 4e0i:A | 152 | 89 | 0.2830 | 0.1974 | 0.3371 | 8.24e-19 | 4e0h:A, 4e0i:B, 4e0i:C, 3w4y:A, 3w4y:B, 3w4y:C |
6 | 3gwl:A | 106 | 83 | 0.2170 | 0.2170 | 0.2771 | 1.89e-06 | 3gwl:B |
7 | 3td7:A | 253 | 92 | 0.1981 | 0.0830 | 0.2283 | 7.12e-04 | 3gwn:A, 3gwn:B |
8 | 3lli:A | 251 | 71 | 0.1981 | 0.0837 | 0.2958 | 0.030 | 3llk:A, 3llk:B, 3llk:C |
9 | 3t58:B | 504 | 81 | 0.2075 | 0.0437 | 0.2716 | 0.74 | 4p2l:A, 4p2l:B, 3t58:A, 3t58:C, 3t58:D, 3t59:A, 3t59:B, 3t59:C, 3t59:D |
10 | 2oju:B | 166 | 80 | 0.2075 | 0.1325 | 0.2750 | 1.5 | 2oju:A |
11 | 6igj:A | 167 | 38 | 0.1321 | 0.0838 | 0.3684 | 1.9 | |
12 | 8dgc:A | 2028 | 24 | 0.1132 | 0.0059 | 0.5000 | 2.0 | 8dgc:B, 8dgc:C, 8dgc:D |
13 | 5mrc:S | 185 | 52 | 0.1604 | 0.0919 | 0.3269 | 2.7 | 3j6b:S, 5mre:S, 5mrf:S |
14 | 2w4l:E | 162 | 70 | 0.1698 | 0.1111 | 0.2571 | 3.1 | 2w4l:A, 2w4l:B, 2w4l:D, 2w4l:F |
15 | 2w4l:C | 142 | 69 | 0.1698 | 0.1268 | 0.2609 | 3.2 | |
16 | 7mju:A | 184 | 31 | 0.1415 | 0.0815 | 0.4839 | 3.4 | 5dag:A, 5dah:B, 5dah:A |
17 | 6jbs:A | 762 | 30 | 0.1226 | 0.0171 | 0.4333 | 3.8 | 7ey1:B, 7ey1:A, 7ey2:A, 7ey2:B, 7ey2:C, 7ey2:D, 7ey2:E, 7ey2:F, 7f95:A, 7f95:B, 8gyy:B, 8gyy:A, 8gyy:C, 8gyy:D, 6jbs:C, 6jbs:D, 6kj0:A, 6kj0:B, 7yo6:A, 7yo6:B, 7yo7:B, 7yo7:A |
18 | 3frh:A | 241 | 46 | 0.1132 | 0.0498 | 0.2609 | 3.8 | 3b89:A, 3fri:A |
19 | 5gz4:A | 804 | 37 | 0.1226 | 0.0162 | 0.3514 | 4.2 | 7cba:A, 7cba:B, 5gz5:A |
20 | 9f2k:A | 513 | 17 | 0.0755 | 0.0156 | 0.4706 | 5.9 | |
21 | 6gzt:A | 267 | 68 | 0.1509 | 0.0599 | 0.2353 | 6.1 | 6fdk:A, 6fdq:A, 6fdq:B, 6fdu:B, 6gzs:A |