BioLiP

>protein
DDEGAQWNCTACTFLNHPALIRCEQCEMPRHF

The query sequence (length=32) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3a9j:C	32	29	0.9062	0.9062	1.0000	2.78e-17	9avt:C, 9avw:C, 7e62:C, 7e62:J, 2wwz:C, 2wx0:C, 2wx0:G, 2wx1:C
2	1nj3:A	31	30	0.4062	0.4194	0.4333	8.07e-05	1q5w:A
3	7mnr:B	40	27	0.3125	0.2500	0.3704	0.008
4	7mo2:B	38	26	0.2812	0.2368	0.3462	0.017	3ch5:B, 7mo2:D
5	8im5:A	66	24	0.3438	0.1667	0.4583	0.018	3b0a:E
6	2ebq:A	47	26	0.3125	0.2128	0.3846	0.021	2gqe:A, 2k0c:A
7	2crc:A	52	20	0.3125	0.1923	0.5000	0.023
8	2d9g:A	53	27	0.3438	0.2075	0.4074	0.071
9	7yui:B	232	24	0.3438	0.0474	0.4583	0.12	3b08:K, 3b08:B, 3b08:E, 3b08:H, 3b0a:B
10	8pp6:K	36	24	0.2500	0.2222	0.3333	0.16
11	7mns:B	38	25	0.2812	0.2368	0.3600	0.16
12	7mnt:B	38	25	0.2500	0.2105	0.3200	0.33	7mnt:D, 7mnu:B
13	7mnv:B	38	26	0.2188	0.1842	0.2692	0.52
14	7mnp:B	39	23	0.2500	0.2051	0.3478	0.59	7mnp:D, 7mnq:B
15	6zga:A	751	31	0.3125	0.0133	0.3226	3.8	4bzi:A, 4bzi:D, 4bzi:G, 6gni:A, 1m2o:A, 1m2o:C, 2qtv:A, 6zga:E
16	1m2v:A	705	31	0.3125	0.0142	0.3226	4.0
17	9b4h:A	1908	19	0.2500	0.0042	0.4211	4.0	9b4h:B, 8wa2:A, 8wa2:D, 8wa2:F, 8wa2:B, 8wa2:C, 8wa2:E
18	2c6a:A	46	20	0.2500	0.1739	0.4000	4.6	2c6b:A, 4xxb:B
19	6z2w:E	2325	18	0.3125	0.0043	0.5556	5.2	6z2w:F, 6z2x:E, 6z2x:F, 6z3a:F, 6z3a:E
20	2k1p:A	33	25	0.2188	0.2121	0.2800	6.8
21	7z0s:E	532	15	0.2188	0.0132	0.4667	7.3	7z0t:E
22	2cr8:A	53	21	0.2500	0.1509	0.3810	7.5
23	4v12:A	337	21	0.2812	0.0267	0.4286	9.0
24	7c4c:A	332	13	0.2188	0.0211	0.5385	9.9	7c42:A, 7c43:A, 7c45:A, 7c47:A, 7c4b:A

[Back]