DCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMPVDLDSLSPEERRARFRK
The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8oiq:Bd | 69 | 62 | 1.0000 | 0.8986 | 1.0000 | 1.02e-40 | 5aj4:B4, 6gaw:B4, 6gb2:B4, 7nqh:B4, 7nql:B4, 7nsh:B4, 7nsi:B4, 7nsj:B4, 4v19:4, 6ydp:B4, 6ydw:B4 |
2 | 6i9r:m | 60 | 60 | 0.8226 | 0.8500 | 0.8500 | 1.01e-32 | 7a5i:m3, 7odr:m, 7ods:m, 7oi7:m, 7oi8:m, 7oic:m, 7oid:m, 6zs9:m, 6zsa:m, 6zsb:m, 6zsc:m, 6zsg:m |
3 | 8jh1:B | 462 | 48 | 0.3226 | 0.0433 | 0.4167 | 0.35 | 8jbb:A, 8jbb:B, 8jh1:A |
4 | 4xup:A | 330 | 36 | 0.2419 | 0.0455 | 0.4167 | 1.1 | 4xun:A, 4xun:B, 4xun:C, 4xuo:A, 4xuo:B, 4xup:B, 4xup:C, 4xup:D, 4xup:E, 4xup:F, 4xuq:A, 4xuq:B, 4xuq:C, 4xur:A, 4xur:B, 4xur:C, 4xut:A, 4xut:B, 4xut:C |
5 | 3aw5:A | 438 | 51 | 0.2581 | 0.0365 | 0.3137 | 3.2 | 6k3d:A, 8p4g:A, 8p4g:B |
6 | 7r3a:A | 411 | 18 | 0.1290 | 0.0195 | 0.4444 | 4.0 | 7r3a:B, 7r3a:C, 7r3a:D, 7r3a:E, 7r3a:F, 7r3a:G, 7r3a:H |
7 | 9cpo:A | 930 | 37 | 0.2097 | 0.0140 | 0.3514 | 4.1 | |
8 | 7tvb:A | 558 | 27 | 0.1774 | 0.0197 | 0.4074 | 7.3 | 7tva:A, 7tva:B, 7ubt:A, 7uc6:A, 7uc7:A |