DATDITIYYKTGWTHPHIHYSLNQGAWTTLPGVPLTKSEYEGYVKVTIEAEEGSQLRAAFNNGSGQWDNNQGRDYDFSSG
VHTLADGRILSGTPK
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2c3w:B | 95 | 95 | 1.0000 | 1.0000 | 1.0000 | 4.15e-68 | 2c3w:A, 2c3w:C, 2c3w:D, 2c3x:A |
2 | 4tlm:C | 750 | 21 | 0.1158 | 0.0147 | 0.5238 | 0.40 | 4tll:C |
3 | 3zx1:A | 471 | 75 | 0.2000 | 0.0403 | 0.2533 | 0.50 | |
4 | 2z1a:A | 507 | 22 | 0.1053 | 0.0197 | 0.4545 | 0.65 | |
5 | 5eqc:A | 426 | 25 | 0.1158 | 0.0258 | 0.4400 | 2.4 | 5dj9:A, 5dj9:B, 5e3k:A, 5e3k:B, 5e5i:A, 5e5i:B, 5eqc:B, 4nog:A, 4nog:B, 4zlv:A, 4zlv:B, 4zwm:A, 4zwm:B |
6 | 6je8:A | 469 | 35 | 0.1474 | 0.0299 | 0.4000 | 2.8 | 6jea:A, 6jeb:A |
7 | 6rxt:UQ | 789 | 60 | 0.2105 | 0.0253 | 0.3333 | 3.2 | 6rxu:UQ, 6rxv:UQ, 6rxx:UQ, 6rxy:UQ, 6rxz:UQ |
8 | 3dha:A | 254 | 51 | 0.1789 | 0.0669 | 0.3333 | 3.8 | 2a7m:A, 2br6:A, 2btn:A, 3dhb:A, 3dhc:A, 5eh9:A, 5eht:A, 4j5f:A, 4j5h:A, 7l5f:A |
9 | 2xl7:A | 235 | 27 | 0.1263 | 0.0511 | 0.4444 | 5.7 | 2xl9:A, 2xl9:B, 2xla:A, 2xla:B, 2xla:C, 2xla:D, 2xlg:A |
10 | 7vmx:B | 359 | 66 | 0.2211 | 0.0585 | 0.3182 | 8.8 |