DAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRP
The query sequence (length=35) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gov:N | 110 | 35 | 1.0000 | 0.3182 | 1.0000 | 6.45e-19 | 5lm7:N, 5lm7:F, 5ms0:N, 1qfq:B |
2 | 6n13:B | 322 | 32 | 0.3429 | 0.0373 | 0.3750 | 0.11 | 2jmo:A |
3 | 4zyn:B | 385 | 29 | 0.2857 | 0.0260 | 0.3448 | 1.5 | 4k7d:A, 4k7d:B, 4k7d:C, 4k95:A, 4k95:B, 4k95:C, 4k95:D, 4k95:E, 4k95:F, 4k95:G, 4k95:H, 4k95:I, 4k95:J, 4k95:K, 4k95:L, 7us1:A, 8w31:A, 4zyn:A |
4 | 8fns:A | 105 | 22 | 0.2857 | 0.0952 | 0.4545 | 2.2 | |
5 | 2y7h:A | 464 | 16 | 0.2571 | 0.0194 | 0.5625 | 5.4 |