DAQIIIPNGNYDVTGAGFYSPLNLEIPVGTTVTWTNDDSVPHNIQSIDVNGKVIQLFNSPPLNTGDRFEHVFEEEGVYKY
YCSFHPWRVGLVTVS
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5fc9:A | 95 | 95 | 1.0000 | 1.0000 | 1.0000 | 1.69e-67 | 5fc9:B, 5fc9:C, 5fc9:D |
2 | 6hbe:C | 427 | 92 | 0.3684 | 0.0820 | 0.3804 | 1.88e-10 | 6hbe:A, 6hbe:B |
3 | 1aac:A | 105 | 84 | 0.2842 | 0.2571 | 0.3214 | 1.79e-09 | 1aan:A, 1bxa:A, 2gb2:A, 2gba:A, 2gc4:C, 2gc4:G, 2gc4:K, 2gc4:O, 2idq:A, 2ids:A, 2idt:A, 2idu:A, 3ie9:A, 3iea:A, 2j55:A, 2j55:B, 2j56:A, 2j56:B, 2j57:A, 2j57:B, 2j57:C, 2j57:D, 3l45:A, 1mda:A, 1mda:B, 1mg2:C, 1mg2:G, 1mg2:K, 1mg2:O, 1mg3:C, 1mg3:G, 1mg3:K, 1mg3:O, 2mta:A, 2ov0:A, 4p5r:A, 4p5s:A, 3ply:A, 3ply:B, 3ply:C, 3ply:D, 2qdv:A, 2qdw:A, 2rac:A, 3rym:A, 3rym:C, 3rym:B, 3rym:D, 1sf3:A, 1sf5:A, 1sfd:A, 1sfd:B, 1sfh:A, 1sfh:B, 1t5k:A, 1t5k:B, 1t5k:C, 1t5k:D |
4 | 1bxu:A | 91 | 67 | 0.2526 | 0.2637 | 0.3582 | 4.50e-08 | 1bxv:A |
5 | 1j5c:A | 98 | 76 | 0.2421 | 0.2347 | 0.3026 | 7.90e-07 | 1j5d:A, 1jxd:A, 1jxf:A, 1pcs:A |
6 | 6yez:P | 99 | 85 | 0.2737 | 0.2626 | 0.3059 | 2.43e-05 | 6zoo:P |
7 | 3c75:A | 106 | 71 | 0.2316 | 0.2075 | 0.3099 | 2.80e-05 | 3c75:B, 1id2:A, 1id2:B, 1id2:C |
8 | 1byo:A | 99 | 89 | 0.2842 | 0.2727 | 0.3034 | 1.13e-04 | 1byo:B, 1byp:A |
9 | 1pla:A | 97 | 72 | 0.2526 | 0.2474 | 0.3333 | 2.44e-04 | 1plb:A |
10 | 4dp0:X | 99 | 91 | 0.2737 | 0.2626 | 0.2857 | 2.96e-04 | 4dp1:X, 4dp2:X, 4dp4:X, 4dp5:X, 4dp6:X |
11 | 4r0o:A | 106 | 92 | 0.3158 | 0.2830 | 0.3261 | 5.93e-04 | 1baw:A, 1baw:B, 1baw:C, 3bqv:A, 3cvb:A, 3cvb:B, 3cvc:A, 3cvd:A, 3cvd:B, 3cvd:C, 2q5b:A, 2q5b:B, 2q5b:C, 4r0o:B, 4r0o:C, 4r0o:D, 2w88:A, 2w88:B, 2w88:C, 2w8c:A, 2w8c:B |
12 | 1ag6:A | 99 | 89 | 0.2632 | 0.2525 | 0.2809 | 6.94e-04 | 1oow:A, 2pcf:A, 1tef:A, 1tef:B, 1teg:A, 1teg:B, 1ylb:B |
13 | 9pcy:A | 99 | 93 | 0.2421 | 0.2323 | 0.2473 | 0.001 | |
14 | 1jxg:A | 100 | 89 | 0.2947 | 0.2800 | 0.3146 | 0.002 | 4dp7:X, 4dp8:X, 4dp9:X, 4dpa:X, 4dpb:X, 4dpc:X, 1jxg:B, 3pcy:A, 4pcy:A, 5pcy:A, 6pcy:A, 1plc:A, 1pnc:A, 1pnd:A, 1tkw:A |
15 | 2plt:A | 98 | 81 | 0.2737 | 0.2653 | 0.3210 | 0.038 | 7zqe:M |
16 | 1b3i:A | 97 | 84 | 0.2421 | 0.2371 | 0.2738 | 0.12 | 2b3i:A, 2jxm:A |
17 | 6zk8:A | 410 | 38 | 0.1263 | 0.0293 | 0.3158 | 0.70 | 6frm:A, 6frm:B, 6frm:C, 6frm:D, 6frm:E, 6frm:H, 6frm:F, 6frm:G, 6frn:A, 6frn:B, 6frn:C, 6frn:D, 6zk8:O, 6zlf:A, 6zlf:F, 6zlf:G, 6zlf:H, 6zlf:I, 6zlf:J, 6zlf:K, 6zlf:L |
18 | 1dth:A | 202 | 30 | 0.1263 | 0.0594 | 0.4000 | 0.86 | 1atl:A, 1atl:B, 1dth:B, 1htd:A, 1htd:B |
19 | 1g4u:S | 360 | 44 | 0.1368 | 0.0361 | 0.2955 | 3.2 | |
20 | 5xla:A | 490 | 36 | 0.1158 | 0.0224 | 0.3056 | 6.1 | 3eyk:B, 5xl3:B, 5xl3:A, 5xl4:A, 5xl4:B, 5xl6:A, 5xl7:A, 5xl7:B, 5xl9:A, 5xla:B, 5xlc:A, 5xlc:B, 5xld:A, 5xld:B |
21 | 5w3d:B | 313 | 42 | 0.1684 | 0.0511 | 0.3810 | 7.5 |