DAIDDKTWSKLFPSIVSDPDRSSNFMIRAIYVVFSAVLRQRNILEKEYFSKNYITENLSCMTLSFKNLRAHQIAQLLRAA
GDATKDGFLKEISLVVTEHDGDVEAIEVFSMKFIYFENGGVVARLPHFAELAQLRYEGAESVRDQMVTIVRSVQFLCTKV
LEPLPAEFTANFRLKYTNDAPSNFRIDGFDDSSTFYTLPDGIQSVTIGHLRPGHHAAHMQCWSKSM
The query sequence (length=226) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4tzm:A | 239 | 228 | 1.0000 | 0.9456 | 0.9912 | 3.33e-171 | 4tzl:A, 4tzl:B, 4tzm:B, 4tzn:A, 4tzn:B, 4tzs:A, 4tzs:B |
2 | 4tzq:C | 237 | 235 | 0.8407 | 0.8017 | 0.8085 | 4.81e-143 | 4tzo:A, 4tzo:C, 4tzo:E, 4tzo:G, 4tzq:A |
3 | 1gpl:A | 432 | 89 | 0.1018 | 0.0532 | 0.2584 | 0.18 | |
4 | 1hpl:A | 449 | 62 | 0.0841 | 0.0423 | 0.3065 | 0.20 | 1hpl:B |
5 | 1lpa:B | 449 | 62 | 0.0841 | 0.0423 | 0.3065 | 0.60 | 1lpb:B |
6 | 6iil:A | 341 | 104 | 0.0973 | 0.0645 | 0.2115 | 2.6 | 6iik:A, 6iik:B, 6iil:B, 6iim:A, 6iim:B, 6iin:A, 6iin:B |
7 | 2xn9:C | 215 | 88 | 0.0973 | 0.1023 | 0.2500 | 7.6 | 1ewc:A, 1hxy:D |
8 | 1eth:A | 448 | 60 | 0.0752 | 0.0379 | 0.2833 | 8.1 | 1eth:C |
9 | 5tmb:A | 451 | 40 | 0.0664 | 0.0333 | 0.3750 | 9.4 | 6bk0:A, 6bk1:A, 6bk2:A, 6bk3:A, 5tmd:A, 5tme:A |