DADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRAR
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ve9:C | 74 | 74 | 1.0000 | 1.0000 | 1.0000 | 1.68e-50 | |
2 | 1v5r:A | 97 | 75 | 0.3919 | 0.2990 | 0.3867 | 1.73e-13 | |
3 | 7oh9:L | 96 | 32 | 0.1757 | 0.1354 | 0.4062 | 4.5 | 5fz5:U, 6gyl:U, 6gym:U |
4 | 5fmf:M | 116 | 32 | 0.1757 | 0.1121 | 0.4062 | 5.0 | 8cen:U, 8ceo:U, 7ml1:U, 7ml4:U, 1nh2:C, 7o4i:U, 7o4j:U, 7o72:U, 7o73:U, 7o75:U, 7oha:L, 5sva:d, 1ytf:C, 7zs9:U, 7zsa:U, 7zsb:U |
5 | 7za1:E | 251 | 28 | 0.1622 | 0.0478 | 0.4286 | 8.3 | 7za1:F, 7za1:H, 7za2:E, 7za2:G, 7za3:E, 7za3:G |
6 | 6nts:B | 361 | 23 | 0.1081 | 0.0222 | 0.3478 | 8.7 | |
7 | 7cr7:A | 354 | 24 | 0.1486 | 0.0311 | 0.4583 | 9.5 | 7cr1:A, 7cr1:B, 7cr1:C, 7cr1:D, 7cr2:B, 7cr2:C, 7cr2:D, 7cr2:A, 7cr4:A, 7cr4:B, 7cr4:D, 7cr4:F, 7cr7:G, 7cr7:B, 7cr7:D, 8ijk:A, 8ijk:C, 8ijk:B, 8ijk:D, 8izy:A, 8izy:B, 8izy:D, 8izy:C, 8j01:G, 8j01:A, 8j01:B, 8j01:D, 8j02:G, 8j02:A, 8j02:B, 8j02:D, 8j03:A, 8j03:D, 8j03:G, 8j03:I, 8j04:A, 8j04:G, 8j04:B, 8j04:D, 8w4u:A, 8w4u:B, 8w4u:D, 8w4u:G |