DADDLDLQRVGARLAARAQIRDIRLLRTQAAVHRAPKLTYDLEFEPAVDADPATISAFVVRISCHLRIQNQDVATADFEF
AALFDYHLQEGEDDPTEEELTAYAATTGRFALYPYIREYVYDLTGRLALPPLTLEILS
The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5mtw:C | 138 | 138 | 0.9275 | 0.9275 | 0.9275 | 2.07e-82 | 5mtw:A, 5mtw:D, 5mtw:B |
2 | 5hxm:A | 1060 | 49 | 0.1159 | 0.0151 | 0.3265 | 1.4 | 5f7u:A, 5hpo:A, 5i0d:A, 5i0d:B, 4kmq:A, 4kwu:A |
3 | 1ozb:A | 144 | 23 | 0.0797 | 0.0764 | 0.4783 | 6.4 | 1ozb:B, 1ozb:C, 1ozb:D |
4 | 6o9l:T | 237 | 51 | 0.0942 | 0.0549 | 0.2549 | 9.9 | 8bvw:R, 8byq:R, 8bz1:R, 7eg8:T, 7ega:T, 7egb:T, 7egc:T, 7ena:FB, 7enc:FB, 8gxq:FB, 8gxs:FB, 5iy6:T, 5iy7:T, 5iy8:T, 5iy9:T, 5iya:T, 5iyb:T, 5iyc:T, 5iyd:T, 7lbm:T, 7nvr:R, 7nvs:R, 7nvt:R, 7nvu:R, 7nvy:R, 7nvz:R, 7nw0:R, 8s51:R, 8s52:R, 8s5n:R, 8wak:T, 8wal:T, 8wan:T, 8wao:T, 8wap:T, 8waq:T, 8war:T, 8was:T, 7zwd:R, 7zx7:R, 7zx8:R |