BioLiP

>protein
CTSVVAQDSRGHIYHGRNLDYPFGDLLRKMTVDVQFLKNGQIAFTGTTFIGYVGLWTGQSPYKFTVSGDERADKGWWWEN
MIAALFQGHSPVSWLIRTTLSESEDFEASVYKLAKTPLIADVYYIVGGTAPGEGVVVTRNRGGPADIWPLDPLNGAWFRV
ETNYDHWKPVPKSDDRRTPAIKALNATGQANLSLEALFQVLSVVPVCNKITVYTTVMSAATPDKYMTRIRNL

The query sequence (length=232) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6dy2:B	232	232	1.0000	1.0000	1.0000	5.24e-176	6dy2:D
2	6dxx:B	231	231	0.8750	0.8788	0.8788	3.04e-153	6dxx:D, 6dxx:F
3	6dy0:B	231	231	0.8405	0.8442	0.8442	7.24e-150	6dxz:B
4	6mhm:B	253	247	0.4052	0.3715	0.3806	5.41e-54	6mhm:D
5	5u81:A	369	246	0.3879	0.2439	0.3659	4.96e-49
6	5u84:B	353	243	0.3750	0.2465	0.3580	2.25e-46	5u84:A
7	9cp7:A	436	80	0.0948	0.0505	0.2750	1.1	9cp7:B, 9cp8:A, 9cp8:B, 9cp9:A, 9cp9:B, 8v35:A, 8v36:A, 8v37:A
8	8gr9:A	432	47	0.0776	0.0417	0.3830	1.1
9	1v9h:A	193	108	0.1207	0.1451	0.2593	1.6	1j1f:A, 1j1g:A, 1uca:A, 1ucc:A, 1ucd:A
10	8sy6:J	1269	93	0.0991	0.0181	0.2473	2.1
11	8esi:A	316	23	0.0517	0.0380	0.5217	2.4	8esi:B, 8esi:C, 8esi:D, 8esi:E, 8esi:F, 8esi:G, 8esi:H, 8ete:A, 8ete:B
12	6tu2:A	314	47	0.0733	0.0541	0.3617	3.3	6tu2:B, 6tu2:C
13	5yjl:B	415	70	0.0776	0.0434	0.2571	4.7	5yjl:A
14	8etk:A	321	20	0.0431	0.0312	0.5000	6.8	8etk:B, 8ewt:A, 8ewt:B, 7svg:A, 7svg:D
15	7eo3:A	282	67	0.0948	0.0780	0.3284	6.9

[Back]