CTSILYSPKDHYFGRNLDYEIAYGQKVVITPRNYEFKFANLPAEKSHYAMIGIAAVANNTPLYCDAINEKGLGVAGLSFA
GQGKYFPVVEDKKNIASFEFISYILATYETVDQVKENLTDVNISDVSFSKNTPASELHWLVGDKTGKSIVVESDEKGLHV
YDNPVNALTNAPLFPQQLTNLANYAAVVPGQPNNDFLPGVDLKMYSRSLGTHHLPGGMDSESRFVKVCFALNHAPKDSDE
VESVTNFFHILQSVEQVKGMDEVGPNIFEYTMYTSCMNLEKGILYFNCYDDSRISAVDMNKEDLSSSDLIVFDLFKKQDI
SFIN
The query sequence (length=324) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8etf:C | 330 | 324 | 1.0000 | 0.9818 | 1.0000 | 0.0 | 8esg:A, 8esg:H, 8etf:H, 8etf:A, 8etf:B, 8etf:D, 8etf:E, 8etf:F, 8etf:G, 8fao:H, 8fao:A, 8fao:B, 8fao:C, 8fao:D, 8fao:E, 8fao:F, 8fao:G |
2 | 7svj:B | 326 | 326 | 0.4784 | 0.4755 | 0.4755 | 2.64e-108 | |
3 | 5y7p:A | 327 | 325 | 0.4290 | 0.4251 | 0.4277 | 2.82e-87 | 8bls:A, 8bls:B, 8bls:C, 8bls:D, 8bls:E, 8bls:F, 8bls:G, 8bls:H, 8blt:A, 8blt:B, 8blt:C, 8blt:D, 8blt:E, 8blt:F, 8blt:G, 8blt:H, 5y7p:F |
4 | 2bjf:A | 328 | 330 | 0.3796 | 0.3750 | 0.3727 | 1.50e-71 | 2rlc:A |
5 | 8esi:A | 316 | 317 | 0.3519 | 0.3608 | 0.3596 | 1.36e-63 | 8esi:B, 8esi:C, 8esi:D, 8esi:E, 8esi:F, 8esi:G, 8esi:H, 8ete:A, 8ete:B |
6 | 8vsy:B | 320 | 316 | 0.3611 | 0.3656 | 0.3703 | 6.55e-61 | 8u7n:B, 8vrx:B, 8vsy:A |
7 | 2z71:C | 331 | 329 | 0.3519 | 0.3444 | 0.3465 | 1.05e-52 | 2z71:A |
8 | 8etk:A | 321 | 317 | 0.3210 | 0.3240 | 0.3281 | 6.71e-52 | 8etk:B, 8ewt:A, 8ewt:B, 7svg:A, 7svg:D |
9 | 8esl:A | 309 | 309 | 0.2315 | 0.2427 | 0.2427 | 7.66e-14 | 8esl:B, 8esl:C, 8esl:D |
10 | 6uh4:B | 326 | 310 | 0.2160 | 0.2147 | 0.2258 | 3.24e-12 | |
11 | 5eqx:A | 439 | 140 | 0.1111 | 0.0820 | 0.2571 | 0.050 | |
12 | 2w94:A | 254 | 61 | 0.0494 | 0.0630 | 0.2623 | 0.59 | 2w94:B, 2w94:C, 2w95:A, 2w95:B, 2w95:C, 2wn2:A, 2wn2:B, 2wn2:C, 2wn3:A, 2wn3:B, 2wn3:C |
13 | 1ydn:A | 283 | 130 | 0.1142 | 0.1307 | 0.2846 | 0.63 | 1ydn:B, 1ydn:C, 1ydn:D |
14 | 2arc:B | 164 | 41 | 0.0401 | 0.0793 | 0.3171 | 3.0 | 2aac:A, 2aac:B, 2arc:A |
15 | 4ls9:A | 319 | 86 | 0.0710 | 0.0721 | 0.2674 | 3.1 | 4ls9:B |
16 | 4lt6:A | 467 | 56 | 0.0679 | 0.0471 | 0.3929 | 3.7 | 4lt6:B |
17 | 6lja:A | 841 | 104 | 0.0957 | 0.0369 | 0.2981 | 3.8 | 6ljl:A |
18 | 6clv:C | 257 | 108 | 0.0802 | 0.1012 | 0.2407 | 4.9 | 1ad4:A, 6clv:A, 6clv:B |
19 | 6cds:A | 325 | 35 | 0.0432 | 0.0431 | 0.4000 | 6.4 | 6cds:B, 7lwh:A, 4p7i:A, 4p7i:B, 3wa0:A, 3wa0:B, 3wa0:C, 3wa0:E, 3wa0:F, 4zri:A, 4zri:B, 4zrk:A, 4zrk:C, 4zrk:B, 4zrk:D |
20 | 4bjh:A | 422 | 97 | 0.0833 | 0.0640 | 0.2784 | 6.5 | 3d6n:A |