CSDIWALQGKSTETNPLYWLRAMDCADRLMPAQSRQQARQYDDGSWQNTFKQGILLADAKITPYERRQLVARIEALSTEI
PAQVRPLYQLWRDGQALQLQLAEERQRYSKLQQSSDSELDTLRQQHHVLQQQLELTTRKLENLTDIERQL
The query sequence (length=150) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7x6f:B | 150 | 150 | 1.0000 | 1.0000 | 1.0000 | 3.17e-107 | 7x6f:C |
2 | 7mf3:B | 896 | 64 | 0.1467 | 0.0246 | 0.3438 | 0.26 | 1br1:A, 1br1:C, 1br1:E, 1br1:G, 1br4:A, 1br4:C, 1br4:E, 1br4:G, 7mf3:A, 6z47:A, 6z47:B |
3 | 8ppb:A | 276 | 83 | 0.1333 | 0.0725 | 0.2410 | 2.9 | 8pp8:A, 8pp8:B, 8pp9:A, 8pp9:B, 8ppa:A, 8ppa:B, 8ppb:B, 8ppc:A, 8ppc:B, 8ppd:A, 8ppd:B, 8ppe:A, 8ppe:B, 8ppf:A, 8ppf:B, 8ppg:A, 8pph:A, 8pph:B, 8ppi:A, 8ppi:B, 8ppj:A, 8ppj:B, 1tzd:A, 1tzd:B, 1w2c:A, 1w2c:B, 1w2d:A, 1w2d:B |
4 | 1gk0:B | 522 | 62 | 0.1133 | 0.0326 | 0.2742 | 3.0 | 2adv:C, 1gk0:D, 1gk1:B, 1gk1:D, 1jvz:B, 1jw0:B |
5 | 4ohf:B | 458 | 71 | 0.1200 | 0.0393 | 0.2535 | 3.6 | 4ohf:A, 4ohf:C, 4ohf:D |