CRPVVRRARTSDVPAIKQLVDTYAGKILLEKNLVTLYEAVQEFWVAEHPDLYGKVVGCGALHVLWSDLGEIRTVAVDPAM
TGHGIGHAIVDRLLQVARDLQLQRVFVLTFETEFFARHGFTEIEGTPVTAEVFDEMCRSYDIGVAEFLDLSYVKPNILGN
SRMLLVL
The query sequence (length=167) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5yge:A | 169 | 167 | 1.0000 | 0.9882 | 1.0000 | 5.70e-123 | 6add:A, 6add:B, 5yge:B, 5yo2:A, 5yo2:B |
2 | 3b8g:A | 424 | 119 | 0.2335 | 0.0920 | 0.3277 | 8.14e-11 | 3d2m:A, 3d2p:A, 3d2p:B, 4i49:A, 2r8v:A, 2r98:A |
3 | 1i1d:D | 161 | 55 | 0.0838 | 0.0870 | 0.2545 | 0.16 | 1i12:A, 1i12:B, 1i12:C, 1i12:D, 1i1d:A, 1i1d:B, 1i1d:C |
4 | 6ao7:A | 153 | 95 | 0.1138 | 0.1242 | 0.2000 | 0.21 | |
5 | 3icf:A | 316 | 46 | 0.0898 | 0.0475 | 0.3261 | 0.40 | 3icf:B |
6 | 7daj:B | 150 | 52 | 0.0898 | 0.1000 | 0.2885 | 0.52 | 7daj:A, 7dak:A, 7dak:B, 7dal:A, 7dal:B |
7 | 4e0u:A | 408 | 128 | 0.1856 | 0.0760 | 0.2422 | 0.64 | 4e0u:B, 7xvj:A, 7xvj:B, 7xvj:C, 7xvj:D, 7y3v:A, 7y3v:B, 7y3v:C, 7y3v:D |
8 | 3mgd:B | 154 | 58 | 0.0719 | 0.0779 | 0.2069 | 0.77 | 3mgd:A |
9 | 7ssf:A | 72 | 44 | 0.0838 | 0.1944 | 0.3182 | 0.83 | 7ssf:C, 7ssf:E, 7ssf:G |
10 | 5n8o:A | 1432 | 36 | 0.0838 | 0.0098 | 0.3889 | 1.2 | 4l0j:A, 1p4d:A, 1p4d:B, 1p4d:C, 2q7t:A, 2q7t:B, 2q7u:A |
11 | 3smz:A | 280 | 93 | 0.1557 | 0.0929 | 0.2796 | 1.3 | |
12 | 2a0i:A | 293 | 28 | 0.0719 | 0.0410 | 0.4286 | 1.7 | |
13 | 7ak7:A | 154 | 62 | 0.1138 | 0.1234 | 0.3065 | 1.7 | 7ak7:B |
14 | 5xxr:A | 123 | 69 | 0.1078 | 0.1463 | 0.2609 | 2.3 | 5xxr:B, 5xxs:A, 5xxs:B |
15 | 3fm3:A | 356 | 57 | 0.1018 | 0.0478 | 0.2982 | 2.9 | 3fm3:B, 3fmq:A, 3fmq:B, 3fmr:A, 3fmr:B |
16 | 3pp9:A | 176 | 75 | 0.0898 | 0.0852 | 0.2000 | 2.9 | 3pp9:B, 3pp9:C |
17 | 3afg:B | 507 | 39 | 0.0958 | 0.0316 | 0.4103 | 3.2 | 3afg:A |
18 | 3dje:B | 437 | 44 | 0.1018 | 0.0389 | 0.3864 | 5.7 | 3djd:A, 3djd:B, 3dje:A |
19 | 4u82:A | 236 | 40 | 0.0599 | 0.0424 | 0.2500 | 5.9 | 4h8e:A, 3wyi:A |
20 | 3dr8:A | 173 | 82 | 0.1317 | 0.1272 | 0.2683 | 6.7 | 3dr8:B |
21 | 8ssl:A | 1072 | 83 | 0.1377 | 0.0215 | 0.2771 | 7.4 | 5cjt:A, 5cjt:B, 5cju:A, 5cju:B, 5cjv:A, 5cjv:B, 5cjw:A, 5cjw:B, 8ssl:B, 8ssl:C, 4xc6:A, 4xc6:B, 4xc7:A, 4xc8:A, 4xc8:B |
22 | 6ncz:C | 589 | 53 | 0.1078 | 0.0306 | 0.3396 | 8.5 | 6ncz:A, 6ncz:B, 6ncz:D, 6ncz:E, 6ncz:F |
23 | 9bct:M | 648 | 26 | 0.0659 | 0.0170 | 0.4231 | 8.5 | 9bct:J, 9bcu:J, 9bcu:M |