BioLiP

>protein
CRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFCIRCAVV
GNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDI
RDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINDLYMPSTGALMLLTALHTCD
QVSAYGFITSNYWKFSDHYFNHDLSLEAALWRDLHKAGILQLYQR

The query sequence (length=285) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6apl:C	306	306	1.0000	0.9314	0.9314	0.0	6apl:A, 6apl:B, 6apl:D, 6apl:E, 6apl:F
2	2wnb:A	273	222	0.2491	0.2601	0.3198	7.32e-23	2wnf:A
3	5cxy:A	292	174	0.2000	0.1952	0.3276	2.02e-13	5bo6:A, 5bo6:B, 5bo7:A, 5bo7:B, 5bo9:A, 5bo9:B, 5cxy:B
4	4js1:A	318	189	0.1825	0.1635	0.2751	6.05e-11	4js2:A, 6qvt:A, 6qvt:B
5	5zer:A	354	44	0.0596	0.0480	0.3864	0.58	5zer:B, 5zes:A, 5zfk:A, 5zfk:B
6	3iqx:A	261	146	0.1158	0.1264	0.2260	1.4	3iqw:A, 3iqw:B, 3iqx:B
7	4dik:A	402	83	0.0877	0.0622	0.3012	1.8	4dik:B, 4dil:A, 4dil:B, 5v8s:A, 5v8s:B, 1vme:A, 1vme:B
8	1tuu:A	399	61	0.0561	0.0401	0.2623	4.7	1g99:A, 1g99:B, 1tuu:B, 1tuy:A, 1tuy:B
9	5jhx:A	735	41	0.0526	0.0204	0.3659	6.1	5cjh:A, 5cjh:B, 5jhx:B, 5jhy:A, 5jhy:B, 5jhz:A, 5jhz:B, 3ut2:A, 3ut2:B
10	8gzh:C	1052	40	0.0491	0.0133	0.3500	8.7	8gzg:C

[Back]