BioLiP

>protein
CPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERT
CNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFR
LDAHGQAMVFPYHVIGSVVMLEIDNRLCLQNDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEP

The query sequence (length=227) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4zlp:A	241	235	1.0000	0.9419	0.9660	5.13e-163	5czv:A, 5czx:A, 5czx:B, 6xsw:C, 6xsw:F, 6xsw:J, 6xsw:X, 4zlp:B
2	7abv:A	232	231	0.5198	0.5086	0.5108	3.33e-84	3eto:A, 3eto:B, 3i08:A, 3i08:C, 3l95:X, 3l95:Y
3	2oo4:A	226	230	0.5022	0.5044	0.4957	9.04e-69	2oo4:B
4	1pb5:A	35	32	0.0705	0.4571	0.5000	4.20e-04
5	1pb5:A	35	27	0.0485	0.3143	0.4074	5.0
6	8hgg:C	1484	24	0.0617	0.0094	0.5833	0.25	8hgg:D, 8hgh:A, 8hgh:B
7	8hgg:C	1484	31	0.0573	0.0088	0.4194	6.5	8hgg:D, 8hgh:A, 8hgh:B
8	8a7e:C	1524	24	0.0617	0.0092	0.5833	0.27	8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B
9	8a7e:C	1524	31	0.0573	0.0085	0.4194	6.9	8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B
10	4lfl:B	172	33	0.0617	0.0814	0.4242	1.9	4lfl:D, 4lfm:B, 4lfm:D, 4lfn:B, 4lfn:D
11	8oxm:A	2748	19	0.0396	0.0033	0.4737	2.9	8oxm:B
12	7sic:A	2773	19	0.0396	0.0032	0.4737	3.0	8oxo:A, 8oxo:B, 8oxp:A, 8oxp:B, 7sic:B, 7sid:A, 7sid:C
13	7ni5:A	2791	19	0.0396	0.0032	0.4737	3.0	7ni4:A, 7ni4:B, 7ni5:B, 7ni6:A, 7ni6:B, 8oxq:A, 8oxq:B
14	4xfj:B	397	46	0.0705	0.0403	0.3478	6.7	4xfj:A
15	8a7d:Q	273	31	0.0573	0.0476	0.4194	10.0

[Back]