BioLiP

>protein
CPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERT
CNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFR
LDAHGQAMVFPYHRPEVIGSVVMLEIDNRLCLQSPDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEP

The query sequence (length=231) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4zlp:A	241	235	1.0000	0.9585	0.9830	1.78e-166	5czv:A, 5czx:A, 5czx:B, 6xsw:C, 6xsw:F, 6xsw:J, 6xsw:X, 4zlp:B
2	7abv:A	232	232	0.5152	0.5129	0.5129	1.05e-86	3eto:A, 3eto:B, 3i08:A, 3i08:C, 3l95:X, 3l95:Y
3	2oo4:A	226	231	0.4978	0.5088	0.4978	4.69e-71	2oo4:B
4	1pb5:A	35	32	0.0693	0.4571	0.5000	3.81e-04
5	1pb5:A	35	27	0.0476	0.3143	0.4074	4.6
6	8hgg:C	1484	24	0.0606	0.0094	0.5833	0.26	8hgg:D, 8hgh:A, 8hgh:B
7	8hgg:C	1484	31	0.0563	0.0088	0.4194	5.8	8hgg:D, 8hgh:A, 8hgh:B
8	8a7e:C	1524	24	0.0606	0.0092	0.5833	0.27	8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B
9	8a7e:C	1524	31	0.0563	0.0085	0.4194	6.1	8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B
10	4lfl:B	172	33	0.0606	0.0814	0.4242	2.1	4lfl:D, 4lfm:B, 4lfm:D, 4lfn:B, 4lfn:D
11	8oxm:A	2748	19	0.0390	0.0033	0.4737	2.9	8oxm:B
12	7sic:A	2773	19	0.0390	0.0032	0.4737	3.1	8oxo:A, 8oxo:B, 8oxp:A, 8oxp:B, 7sic:B, 7sid:A, 7sid:C
13	7ni5:A	2791	19	0.0390	0.0032	0.4737	3.1	7ni4:A, 7ni4:B, 7ni5:B, 7ni6:A, 7ni6:B, 8oxq:A, 8oxq:B
14	2fsh:A	691	67	0.0779	0.0260	0.2687	4.2	3bxz:A, 3bxz:B, 2fsg:A, 2fsi:A
15	2fsh:B	722	67	0.0779	0.0249	0.2687	6.4
16	2fsi:B	748	67	0.0779	0.0241	0.2687	6.4	2fsg:B
17	6s0k:h	838	67	0.0779	0.0215	0.2687	6.5	5k9t:A, 2vda:A
18	8a7d:Q	273	31	0.0563	0.0476	0.4194	8.4

[Back]