CLLPEVTEEDQGRICVVIDLDETLVHSSFKPIADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTASLAKYA
DPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIP
IFEELSGAEDVYTSLGQL
The query sequence (length=178) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2q5e:A | 181 | 179 | 0.9944 | 0.9779 | 0.9888 | 2.29e-128 | 2q5e:B, 2q5e:C, 2q5e:D, 2q5e:E, 2q5e:F, 2q5e:G, 2q5e:H |
2 | 1t9z:A | 181 | 178 | 0.7584 | 0.7459 | 0.7584 | 5.89e-101 | 6du2:A, 6du2:B, 6du3:A, 6du3:B, 2ghq:A, 2ghq:B, 2ght:A, 2ght:B, 3l0b:A, 3l0c:A, 3l0c:B, 3l0y:A, 3l0y:B, 3pgl:A, 3pgl:B, 1ta0:A, 4ygy:A, 4ygy:B, 4yh1:A, 4yh1:B |
3 | 2hhl:C | 184 | 167 | 0.7921 | 0.7663 | 0.8443 | 5.66e-100 | 2hhl:A, 2hhl:D |
4 | 8ujm:B | 237 | 169 | 0.3989 | 0.2996 | 0.4201 | 8.64e-41 | 8ujm:A |
5 | 4qqf:F | 191 | 156 | 0.3202 | 0.2984 | 0.3654 | 6.34e-29 | 3qle:A |
6 | 3ef1:A | 372 | 108 | 0.1461 | 0.0699 | 0.2407 | 1.03e-05 | 3ef0:A, 4xpz:A, 4xq0:A |
7 | 5ave:A | 252 | 68 | 0.1180 | 0.0833 | 0.3088 | 0.16 | 5avf:A, 5avf:B, 3c8c:A, 3c8c:B, 6iov:A, 6iov:B |
8 | 4avn:A | 420 | 54 | 0.1067 | 0.0452 | 0.3519 | 0.27 | 4avo:A, 4b4f:A, 4b4f:B |
9 | 3shq:A | 299 | 176 | 0.2247 | 0.1338 | 0.2273 | 0.49 | |
10 | 2zu8:A | 373 | 54 | 0.0843 | 0.0402 | 0.2778 | 0.62 | 2zu8:B, 2zu9:B, 2zu9:A |
11 | 1u1h:A | 746 | 93 | 0.1404 | 0.0335 | 0.2688 | 2.1 | 1u1j:A, 1u1u:A, 1u22:A |
12 | 2ilu:A | 477 | 104 | 0.1629 | 0.0608 | 0.2788 | 2.1 | 2imp:A, 2opx:A |
13 | 6m1w:A | 354 | 55 | 0.1067 | 0.0537 | 0.3455 | 2.9 | 8ful:A, 8ful:C, 8ful:E, 8ful:G, 8fum:A, 8fum:C, 8fum:E, 8fum:G, 8fun:A, 8fun:C, 8fuo:A, 8fuo:C, 6m2i:A |
14 | 3o8o:E | 752 | 24 | 0.0618 | 0.0146 | 0.4583 | 3.7 | 3o8o:A, 3o8o:C, 3o8o:G |
15 | 6h3o:F | 650 | 74 | 0.1180 | 0.0323 | 0.2838 | 5.3 | 6h3g:A, 6h3g:B, 6h3g:C, 6h3g:F, 6h3g:D, 6h3g:E, 6h3g:G, 6h3g:H, 6h3o:A, 6h3o:B, 6h3o:C, 6h3o:D, 6h3o:E, 6h3o:G, 6h3o:H, 8il5:A |
16 | 2lcq:A | 161 | 72 | 0.1404 | 0.1553 | 0.3472 | 5.5 | |
17 | 6a30:A | 527 | 98 | 0.1404 | 0.0474 | 0.2551 | 6.4 |