CLAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFDQGTRDVIGLRIAGGAIVWATPDHKVLTEYG
WRAAGELRKGDRVAVRDVETGELRYSVIREVLPTRRARTYDLEVEELHTLVAEGVVVHN
The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2imz:A | 144 | 144 | 0.9424 | 0.9097 | 0.9097 | 8.65e-88 | 5i0a:A, 3ifj:A, 3ifj:B, 3igd:A, 2imz:B, 5k08:A |
| 2 | 5ol7:A | 143 | 56 | 0.1223 | 0.1189 | 0.3036 | 7.33e-06 | |
| 3 | 1zde:A | 160 | 47 | 0.0935 | 0.0813 | 0.2766 | 0.007 | |
| 4 | 4gdp:B | 502 | 50 | 0.1295 | 0.0359 | 0.3600 | 2.5 | 3bi2:A, 3bi2:B, 3bi4:A, 3bi4:B, 3bi5:A, 3bi5:B, 3bnm:B, 3bnm:A, 3bnu:B, 3bnu:A, 3cn8:B, 3cn8:A, 3cnd:B, 3cnd:A, 3cnp:B, 3cnp:A, 3cns:A, 3cns:B, 3cnt:B, 3cnt:A, 4ech:A, 4ech:B, 4gdp:A, 4gdp:C, 4gdp:D, 1rsg:B, 1xpq:A, 1xpq:B, 1xpq:C, 1xpq:D, 1yy5:A, 1yy5:B, 1z6l:A, 1z6l:B |
| 5 | 6z5s:W | 94 | 29 | 0.0863 | 0.1277 | 0.4138 | 4.5 | |
| 6 | 1anw:A | 319 | 29 | 0.0719 | 0.0313 | 0.3448 | 7.9 | 1a8a:A, 1a8b:A, 1anw:B, 1anx:A, 1anx:B, 1anx:C, 1avh:A, 1avh:B, 1avr:A, 1bc0:A, 1bc1:A, 1bc3:A, 1bcw:A, 1bcy:A, 1bcz:A, 1g5n:A, 8gyc:B, 8h0j:A, 8h9z:A, 1hak:B, 1hak:A, 1hvd:A, 1hve:A, 1hvf:A, 6k22:A, 1sav:A, 2xo2:A, 2xo3:A |
| 7 | 3qw4:C | 447 | 49 | 0.1367 | 0.0425 | 0.3878 | 8.1 | 3qw4:B |
| 8 | 5dhm:C | 268 | 38 | 0.0935 | 0.0485 | 0.3421 | 9.6 | 5dhm:D |
umich.edu