CLAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFDQGTRDVIGLRIAGGAILWATPDHKVLTEYG
WRAAGELRKGDRVAVRDVETGELRYSVIREVLPTRRARTFDLEVEELHTLVAEGVVVHACSP
The query sequence (length=142) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2imz:A | 144 | 143 | 0.9296 | 0.9167 | 0.9231 | 1.81e-87 | 5i0a:A, 3ifj:A, 3ifj:B, 3igd:A, 2imz:B, 5k08:A |
2 | 5ol7:A | 143 | 59 | 0.1268 | 0.1259 | 0.3051 | 1.04e-05 | |
3 | 1zde:A | 160 | 121 | 0.1972 | 0.1750 | 0.2314 | 6.82e-04 | |
4 | 4gdp:B | 502 | 50 | 0.1268 | 0.0359 | 0.3600 | 2.6 | 3bi2:A, 3bi2:B, 3bi4:A, 3bi4:B, 3bi5:A, 3bi5:B, 3bnm:B, 3bnm:A, 3bnu:B, 3bnu:A, 3cn8:B, 3cn8:A, 3cnd:B, 3cnd:A, 3cnp:B, 3cnp:A, 3cns:A, 3cns:B, 3cnt:B, 3cnt:A, 4ech:A, 4ech:B, 4gdp:A, 4gdp:C, 4gdp:D, 1rsg:B, 1xpq:A, 1xpq:B, 1xpq:C, 1xpq:D, 1yy5:A, 1yy5:B, 1z6l:A, 1z6l:B |
5 | 6z5s:W | 94 | 29 | 0.0845 | 0.1277 | 0.4138 | 5.1 | |
6 | 8r2c:A | 169 | 43 | 0.0986 | 0.0828 | 0.3256 | 5.9 | |
7 | 7ojl:L | 1498 | 66 | 0.1338 | 0.0127 | 0.2879 | 6.2 | |
8 | 7ojk:L | 1843 | 66 | 0.1338 | 0.0103 | 0.2879 | 6.3 | |
9 | 7ojn:L | 2010 | 66 | 0.1338 | 0.0095 | 0.2879 | 6.3 | 5j1n:A, 5j1p:A, 4miw:A, 7oe7:L |
10 | 3qw4:C | 447 | 49 | 0.1338 | 0.0425 | 0.3878 | 8.0 | 3qw4:B |
11 | 7ef9:A | 414 | 30 | 0.0704 | 0.0242 | 0.3333 | 9.9 | 7ef8:A |