CLAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFDQGTRDVIGLRIAGGAILWATPDHKVLTEYG
The query sequence (length=144) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
2imz:A |
144 |
144 |
1.0000 |
1.0000 |
1.0000 |
1.62e-102 |
5i0a:A, 3ifj:A, 3ifj:B, 3igd:A, 2imz:B, 5k08:A |
2 |
5ol7:A |
143 |
59 |
0.1250 |
0.1259 |
0.3051 |
9.26e-06 |
|
3 |
1zde:A |
160 |
59 |
0.1042 |
0.0938 |
0.2542 |
0.007 |
|
4 |
4gdp:B |
502 |
50 |
0.1250 |
0.0359 |
0.3600 |
2.7 |
3bi2:A, 3bi2:B, 3bi4:A, 3bi4:B, 3bi5:A, 3bi5:B, 3bnm:B, 3bnm:A, 3bnu:B, 3bnu:A, 3cn8:B, 3cn8:A, 3cnd:B, 3cnd:A, 3cnp:B, 3cnp:A, 3cns:A, 3cns:B, 3cnt:B, 3cnt:A, 4ech:A, 4ech:B, 4gdp:A, 4gdp:C, 4gdp:D, 1rsg:B, 1xpq:A, 1xpq:B, 1xpq:C, 1xpq:D, 1yy5:A, 1yy5:B, 1z6l:A, 1z6l:B |
5 |
7zol:B |
1702 |
45 |
0.1042 |
0.0088 |
0.3333 |
5.5 |
7zoq:B |
6 |
6y75:A |
153 |
57 |
0.0972 |
0.0915 |
0.2456 |
5.6 |
6y75:B, 6y75:C, 6y75:D |
7 |
8r2c:A |
169 |
43 |
0.0972 |
0.0828 |
0.3256 |
5.7 |
|
8 |
3h0g:M |
1476 |
66 |
0.1319 |
0.0129 |
0.2879 |
5.7 |
|
9 |
6z5s:W |
94 |
29 |
0.0833 |
0.1277 |
0.4138 |
6.5 |
|
10 |
6iv3:A |
274 |
46 |
0.1042 |
0.0547 |
0.3261 |
7.9 |
6iv0:A, 6iv0:B, 6iv0:C, 6iv0:D, 6iv0:E, 6iv1:A, 6iv1:B, 6iv1:C, 6iv1:D, 6iv1:E, 6iv2:A, 6iv2:B, 6iv2:C, 6iv2:D, 6iv2:E, 6iv3:B, 6iv3:C, 6iv3:D, 6iv3:E, 6iv4:A, 6iv4:B, 6iv4:C, 6iv4:D, 6iv4:E, 6ivj:A, 6ivj:B, 6ivj:C, 6ivj:D, 6ivj:E, 6ivk:A, 6ivk:B, 6ivk:C, 6ivk:D, 6ivk:E, 6ivl:A, 6ivl:B, 6ivl:C, 6ivl:D, 6ivl:E, 6ivm:A, 6ivm:B, 6ivm:C, 6ivm:D, 6ivm:E, 6ivn:A, 6ivn:B, 6ivn:C, 6ivn:D, 6ivn:E, 6ivo:A, 6ivo:B, 6ivo:C, 6ivo:D, 6ivo:E, 6ivp:A, 6ivp:B, 6ivp:C, 6ivp:D, 6ivp:E, 6ivq:A, 6ivq:B, 6ivq:C, 6ivq:D, 6ivq:E, 6ivr:A, 6ivr:B, 6ivr:C, 6ivr:D, 6ivr:E, 6ivw:A, 6ivw:B, 6ivw:C, 6ivw:D, 6ivw:E, 6jlf:A, 6jlf:B, 6jlf:C, 6jlf:D, 6jlf:E, 4wd7:A, 4wd7:B, 4wd7:C, 4wd7:D, 4wd7:E, 4wd8:A, 4wd8:B, 4wd8:C, 4wd8:D, 4wd8:E, 5x87:A, 5x87:B, 5x87:C, 5x87:D, 5x87:E |