BioLiP

>protein
CHRCGSDNVRKMVDSPVGDAWEVYVCEKCCYSWRSTENPVVMEKFKLDDNKIANMGVI

The query sequence (length=58) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7ae4:a	67	58	1.0000	0.8657	1.0000	3.51e-39	7ae4:b, 7ae4:c, 7ae4:d, 7ae4:e, 7ae4:f, 7ae5:b, 7ae5:c, 7ae5:d, 7ae5:e, 7ae5:f, 7ae5:a, 7ae7:a, 7ae7:c, 7ae7:d, 7ae7:e, 7ae7:f
2	8bjd:A	208	25	0.1724	0.0481	0.4000	0.45	8bje:A, 8bk5:A, 2vcd:A
3	6cnb:B	1114	41	0.2759	0.0144	0.3902	0.63	8bws:B, 6cnc:B, 6cnd:B, 6cnf:B, 6eu0:B, 6eu1:B, 6f40:B, 6f41:B, 6f42:B, 6f44:B, 5fj8:B, 5fja:B, 6tut:B, 7z0h:B, 7z1l:B, 7z1m:B, 7z1n:B, 7z1o:B, 7z2z:B, 7z30:B, 7z31:B
4	3cng:C	178	29	0.1724	0.0562	0.3448	0.91	3cng:A, 3cng:B, 3cng:D
5	6vfr:A	428	24	0.1724	0.0234	0.4167	1.7	6vfr:B
6	3sur:A	504	24	0.1552	0.0179	0.3750	2.9	3sus:A, 3sut:A, 3suu:A, 3suv:A, 3suw:A
7	7xw9:R	288	50	0.2586	0.0521	0.3000	2.9	7wkd:R, 7x1t:A, 7x1u:A
8	7pt6:9	341	35	0.2241	0.0381	0.3714	3.9	7pt6:I, 7pt7:9
9	5j55:A	480	20	0.1552	0.0187	0.4500	4.7	5j53:A, 5j54:A, 7qr6:A, 7qr6:B, 7qr6:C
10	8shj:A	334	29	0.1552	0.0269	0.3103	4.8	8shj:B, 8t55:A, 8t55:B
11	6xm7:A	488	15	0.1379	0.0164	0.5333	5.2	6xm6:A, 6xm8:A, 6xm9:A, 6xma:A
12	6j0x:B	466	31	0.2414	0.0300	0.4516	5.6	6j0w:A, 6j0w:B, 6j0x:A, 6j0x:C, 6j0x:D
13	5oh7:C	82	46	0.1552	0.1098	0.1957	5.7
14	8shj:C	306	29	0.1552	0.0294	0.3103	5.8	8t55:C
15	1qyp:A	57	40	0.2414	0.2456	0.3500	7.3
16	8jd6:R	774	15	0.1379	0.0103	0.5333	9.5	7e9h:R, 7e9h:S, 8jd4:4, 8jd5:4, 8jd6:S

[Back]