CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESF
TRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGH
R
The query sequence (length=161) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1eh6:A | 168 | 162 | 1.0000 | 0.9583 | 0.9938 | 2.27e-115 | 1eh7:A, 1eh8:A, 1t38:A, 1t39:A, 1t39:B, 1yfh:C, 1yfh:A, 1yfh:B |
2 | 3kzy:A | 162 | 161 | 0.8571 | 0.8519 | 0.8571 | 1.89e-95 | 3kzy:B, 3kzz:A, 3l00:A, 6y8p:A |
3 | 4wx9:A | 161 | 156 | 0.3602 | 0.3602 | 0.3718 | 4.19e-22 | |
4 | 6ga0:A | 154 | 108 | 0.2112 | 0.2208 | 0.3148 | 1.61e-10 | |
5 | 7e1p:A | 150 | 152 | 0.2671 | 0.2867 | 0.2829 | 1.68e-09 | 7dqq:A |
6 | 4enj:A | 108 | 70 | 0.1429 | 0.2130 | 0.3286 | 1.22e-04 | 4enk:A, 4enm:A, 4enn:A, 4enn:B, 3gx4:X, 3gyh:X, 4hdu:A, 4hdv:A |
7 | 8vc5:A | 488 | 70 | 0.1304 | 0.0430 | 0.3000 | 2.2 | 8vc5:B |
8 | 8eik:C | 407 | 65 | 0.1304 | 0.0516 | 0.3231 | 3.8 | |
9 | 2p3i:A | 161 | 29 | 0.0745 | 0.0745 | 0.4138 | 5.8 | 1kqr:A, 2p3j:A, 2p3k:A, 3tb0:A |
10 | 5van:A | 861 | 47 | 0.1056 | 0.0197 | 0.3617 | 6.4 | 6nfj:A, 6nfj:D, 5vaq:A |
11 | 5xu6:C | 379 | 43 | 0.0870 | 0.0369 | 0.3256 | 7.5 | 5xu6:A, 5xu6:B, 5xu6:D |
12 | 4o7p:B | 451 | 84 | 0.1429 | 0.0510 | 0.2738 | 7.9 |