CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLK
VVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHR
The query sequence (length=151) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1eh6:A | 168 | 162 | 1.0000 | 0.8988 | 0.9321 | 7.16e-107 | 1eh7:A, 1eh8:A, 1t38:A, 1t39:A, 1t39:B, 1yfh:C, 1yfh:A, 1yfh:B |
2 | 3kzy:A | 162 | 157 | 0.8742 | 0.8148 | 0.8408 | 2.26e-91 | 3kzy:B, 3kzz:A, 3l00:A, 6y8p:A |
3 | 4wx9:A | 161 | 156 | 0.3907 | 0.3665 | 0.3782 | 7.65e-22 | |
4 | 6ga0:A | 154 | 141 | 0.2649 | 0.2597 | 0.2837 | 2.06e-11 | |
5 | 7e1p:A | 150 | 143 | 0.2914 | 0.2933 | 0.3077 | 2.38e-10 | 7dqq:A |
6 | 4enj:A | 108 | 70 | 0.1523 | 0.2130 | 0.3286 | 9.78e-05 | 4enk:A, 4enm:A, 4enn:A, 4enn:B, 3gx4:X, 3gyh:X, 4hdu:A, 4hdv:A |
7 | 2p3i:A | 161 | 29 | 0.0795 | 0.0745 | 0.4138 | 5.3 | 1kqr:A, 2p3j:A, 2p3k:A, 3tb0:A |
8 | 8vc5:A | 488 | 76 | 0.1391 | 0.0430 | 0.2763 | 6.3 | 8vc5:B |
9 | 4o7p:B | 451 | 84 | 0.1523 | 0.0510 | 0.2738 | 6.9 | |
10 | 5xu6:C | 379 | 43 | 0.0927 | 0.0369 | 0.3256 | 7.2 | 5xu6:A, 5xu6:B, 5xu6:D |
11 | 5olu:A | 310 | 32 | 0.0795 | 0.0387 | 0.3750 | 7.6 |