CEMKRTTLDSPLGKLELSGCEQGLHEIIFLGGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKL
LKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPCHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3kzy:A | 162 | 161 | 1.0000 | 0.9691 | 0.9752 | 1.71e-112 | 3kzy:B, 3kzz:A, 3l00:A, 6y8p:A |
2 | 1eh6:A | 168 | 165 | 0.8726 | 0.8155 | 0.8303 | 3.98e-94 | 1eh7:A, 1eh8:A, 1t38:A, 1t39:A, 1t39:B, 1yfh:C, 1yfh:A, 1yfh:B |
3 | 4wx9:A | 161 | 156 | 0.3567 | 0.3478 | 0.3590 | 1.13e-16 | |
4 | 6ga0:A | 154 | 145 | 0.2930 | 0.2987 | 0.3172 | 9.27e-15 | |
5 | 7e1p:A | 150 | 144 | 0.2866 | 0.3000 | 0.3125 | 8.90e-11 | 7dqq:A |
6 | 8vc5:A | 488 | 69 | 0.1274 | 0.0410 | 0.2899 | 3.7 | 8vc5:B |
7 | 5cu1:A | 197 | 63 | 0.1146 | 0.0914 | 0.2857 | 4.5 | |
8 | 2p3i:A | 161 | 35 | 0.0828 | 0.0807 | 0.3714 | 6.0 | 1kqr:A, 2p3j:A, 2p3k:A, 3tb0:A |
9 | 4enj:A | 108 | 46 | 0.0764 | 0.1111 | 0.2609 | 7.5 | 4enk:A, 4enm:A, 4enn:A, 4enn:B, 3gx4:X, 3gyh:X, 4hdu:A, 4hdv:A |
10 | 5xr2:C | 295 | 90 | 0.1338 | 0.0712 | 0.2333 | 9.8 | 5xr3:E |