CAEFRIKYVGAIEKLGPLDLINYIDVAQQDFVPPEEEFIMGVSKYGIKHRHALYLIIRMVCYDDKSLLALKTTYSLWVYQ
CNSLEQAQAICKVLSTAFDSV
The query sequence (length=101) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4jif:A | 130 | 130 | 1.0000 | 0.7769 | 0.7769 | 5.69e-60 | 4dx9:m, 4dx9:1, 4dx9:C, 4dx9:G, 4dx9:E, 4dx9:I, 4dx9:4, 4dx9:K, 4dx9:5, 4dx9:M, 4dx9:c, 4dx9:e, 4dx9:g, 4dx9:Q, 4dx9:S, 4dx9:W, 4dx9:Y |
2 | 4dx9:0 | 110 | 113 | 0.9505 | 0.8727 | 0.8496 | 4.39e-58 | 4dx9:k, 4dx9:3, 4dx9:A, 4dx9:s, 4dx9:u, 4dx9:i, 4dx9:U |
3 | 4dx9:O | 102 | 108 | 0.9208 | 0.9118 | 0.8611 | 3.08e-55 | 4dx9:a |
4 | 4dx9:y | 93 | 102 | 0.8416 | 0.9140 | 0.8333 | 2.31e-50 | |
5 | 4dx9:2 | 91 | 103 | 0.8515 | 0.9451 | 0.8350 | 2.92e-49 | |
6 | 4dx9:o | 63 | 98 | 0.5347 | 0.8571 | 0.5510 | 1.35e-16 | |
7 | 6m13:b | 688 | 39 | 0.1287 | 0.0189 | 0.3333 | 2.1 | 7dsy:a, 7dsy:b, 7dts:a, 7dts:b, 7elw:a, 7elw:b, 6m11:a, 6m11:b, 6m12:a, 6m12:b, 6m13:a, 4o1o:A, 4o1o:B, 4o1o:C, 4o1o:D, 4o1p:A, 4o1p:B, 4o1p:C, 4o1p:D |
8 | 6rm3:SJ0 | 171 | 50 | 0.1386 | 0.0819 | 0.2800 | 2.4 | |
9 | 7d4c:A | 595 | 26 | 0.0990 | 0.0168 | 0.3846 | 2.4 | 7c3h:A, 7c3h:B, 7c3i:A, 7c3i:B, 7c3j:A, 7c3j:B, 7c3l:A, 7c3l:B, 7d4d:A, 7d4e:A, 3x0v:A, 3x0v:B |
10 | 8u2o:A | 289 | 49 | 0.1584 | 0.0554 | 0.3265 | 3.6 | 9cmz:A, 9cmz:B, 9cmz:C, 8u2o:B |
11 | 6o9l:Q | 430 | 26 | 0.1089 | 0.0256 | 0.4231 | 4.5 | 8bvw:W, 8byq:W, 7eg9:U, 7ega:U, 7egb:U, 7egc:U, 7ena:EA, 7enc:EA, 5gpy:A, 8gxq:EA, 8gxs:EA, 5iy6:Q, 5iy8:Q, 5iy9:Q, 5iya:Q, 5iyb:Q, 5iyc:Q, 5iyd:Q, 7lbm:Q, 7nvr:W, 7nvs:W, 7nvt:W, 7nvu:W, 7nvy:W, 7nvz:W, 7nw0:W, 8s51:W, 8s52:W, 8s54:W, 8s55:W, 8s5n:W, 1vd4:A, 8wak:U, 8wal:U, 8wan:U, 8wao:U, 8wap:U, 8waq:U, 8war:U, 8was:U |