Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
CAEFRIKYVGAIEKGLEGPLDLINYIDVAKLPFVPIMGVSKYGIKRHALYLIIRMVCYDDGGKSLLALKTTEYSLWVYQC
NSLEQAQAICKVLSTAFDS

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 4jif:A 130 129 0.9899 0.7538 0.7597 2.41e-54 4dx9:m, 4dx9:1, 4dx9:C, 4dx9:G, 4dx9:E, 4dx9:I, 4dx9:4, 4dx9:K, 4dx9:5, 4dx9:M, 4dx9:c, 4dx9:e, 4dx9:g, 4dx9:Q, 4dx9:S, 4dx9:W, 4dx9:Y
2 4dx9:O 102 109 0.9293 0.9020 0.8440 1.21e-53 4dx9:a
3 4dx9:0 110 115 0.9091 0.8182 0.7826 1.33e-49 4dx9:k, 4dx9:3, 4dx9:A, 4dx9:s, 4dx9:u, 4dx9:i, 4dx9:U
4 4dx9:2 91 102 0.8283 0.9011 0.8039 8.66e-46
5 4dx9:y 93 106 0.8283 0.8817 0.7736 1.27e-42
6 4dx9:o 63 96 0.5657 0.8889 0.5833 5.26e-19
7 7de9:A 58 21 0.0909 0.1552 0.4286 8.5

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218