CAEFRIKYVGAIEEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKHRHALYLIIRMVCYDDGKSLLALKTTEYS
LWVYQCNSLEQAQAICKVLSTAFDSV
The query sequence (length=106) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4jif:A | 130 | 130 | 1.0000 | 0.8154 | 0.8154 | 1.10e-66 | 4dx9:m, 4dx9:1, 4dx9:C, 4dx9:G, 4dx9:E, 4dx9:I, 4dx9:4, 4dx9:K, 4dx9:5, 4dx9:M, 4dx9:c, 4dx9:e, 4dx9:g, 4dx9:Q, 4dx9:S, 4dx9:W, 4dx9:Y |
2 | 4dx9:0 | 110 | 113 | 0.9528 | 0.9182 | 0.8938 | 1.17e-64 | 4dx9:k, 4dx9:3, 4dx9:A, 4dx9:s, 4dx9:u, 4dx9:i, 4dx9:U |
3 | 4dx9:O | 102 | 109 | 0.9151 | 0.9510 | 0.8899 | 2.02e-62 | 4dx9:a |
4 | 4dx9:y | 93 | 107 | 0.8302 | 0.9462 | 0.8224 | 2.12e-50 | |
5 | 4dx9:2 | 91 | 108 | 0.8113 | 0.9451 | 0.7963 | 1.79e-48 | |
6 | 4dx9:o | 63 | 102 | 0.5283 | 0.8889 | 0.5490 | 5.92e-18 | |
7 | 6st5:A | 913 | 30 | 0.1132 | 0.0131 | 0.4000 | 0.37 | |
8 | 1fdj:A | 363 | 28 | 0.1132 | 0.0331 | 0.4286 | 1.4 | 1fdj:B |
9 | 5o1n:A | 442 | 49 | 0.1415 | 0.0339 | 0.3061 | 5.5 | 5l78:A, 5l78:B, 5o1o:A, 5o1o:B |
10 | 3a31:A | 465 | 28 | 0.0943 | 0.0215 | 0.3571 | 7.3 | 3a32:A |
11 | 4gmk:A | 227 | 31 | 0.1132 | 0.0529 | 0.3871 | 7.5 | 4gmk:B |
12 | 8unf:A | 187 | 45 | 0.1415 | 0.0802 | 0.3333 | 9.2 | 3u5z:A, 3u5z:K, 3u60:A, 8uh7:A, 8uk9:A, 8uk9:Q |