BioLiP

>protein
AYLRDGKSNLVSKVVELHGETYATTVKMGLSKTPNTATSAKVKIDAAYLETYNKAHNTDFALYPQDLVTFANEGILTVNA
NTKSAEVEMTIRAGEGLQEDKTYAIPVAISDQSSDITIKDEDAKHCIYLVKDMRNAGDAYKGEGVMQGYLFFEVNDVNPL
NTLSFQLENGKLLWDVVVLFAANINYDAEAGRPRVQCNPNVQYLLDNNETLLQPLRRRGVKVLLGLLGNHDITGLAQLSE
QGAKDFAREVAQYCKAYNLDGVNYDDEYSNSPDLSNPSLTNPSTAAAARLCYETKQAMPDKLVTVFDWGQMYGVATVDGV
DAKEWIDIVVANYGSAAYPIGQMTKKQCSGISMEFNLGGGGSLSASKAQSMIDGGYGWFMGFAPSPAKYGSVFSRLQGGG
EVLYGSNVAAPTIFYKKNDPTPYKYPDDL

The query sequence (length=429) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7nwf:A	432	429	1.0000	0.9931	1.0000	0.0	6t8k:A, 6t8k:B, 6t8l:A, 6tcw:A
2	6tcv:B	397	428	0.9207	0.9950	0.9229	0.0
3	6ve1:C	268	235	0.1818	0.2910	0.3319	3.96e-32	1c8y:A, 6ve1:B, 6ve1:D
4	8u9f:A	271	164	0.1515	0.2399	0.3963	3.68e-31	8u48:B, 8u48:A
5	6hm1:A	386	62	0.0606	0.0674	0.4194	0.10
6	3co4:A	311	94	0.0513	0.0707	0.2340	0.93
7	6t9m:AAA	350	36	0.0350	0.0429	0.4167	2.2
8	4wv3:B	518	47	0.0326	0.0270	0.2979	2.4	4wv3:A
9	3dzd:A	368	86	0.0583	0.0679	0.2907	2.9	3dzd:B
10	3fwz:A	140	35	0.0303	0.0929	0.3714	3.2	3fwz:B
11	8uw8:A	738	83	0.0583	0.0339	0.3012	6.5
12	6tr4:A	506	189	0.0932	0.0791	0.2116	6.6	6tr3:A, 6tr4:B

[Back]