AYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQ
HDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPFLPD
QIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVL
EDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQAGVWPAAVR
ESVPSLL
The query sequence (length=327) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 11as:A | 327 | 327 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 11as:B, 12as:A, 12as:B |
2 | 4mlz:A | 299 | 104 | 0.0917 | 0.1003 | 0.2885 | 0.44 | 4mlz:B |
3 | 4ex5:A | 486 | 47 | 0.0642 | 0.0432 | 0.4468 | 1.1 | 4ex5:B |
4 | 1b8a:A | 438 | 82 | 0.0703 | 0.0525 | 0.2805 | 1.8 | 1b8a:B, 3nel:A, 3nem:A, 3nem:B |
5 | 6yo9:A | 398 | 34 | 0.0398 | 0.0327 | 0.3824 | 3.0 | 6twk:A, 6twk:B, 6yo9:B |
6 | 3a74:A | 484 | 44 | 0.0703 | 0.0475 | 0.5227 | 4.1 | 3a74:B, 3a74:C, 3a74:D, 3e9h:A, 3e9h:B, 3e9h:C, 3e9h:D, 3e9i:A, 3e9i:B, 3e9i:C, 3e9i:D |
7 | 6bni:A | 502 | 36 | 0.0336 | 0.0219 | 0.3056 | 6.0 | 6bni:B, 6c86:A, 6c86:B, 5eln:A, 5eln:B, 5eln:C, 5eln:D, 5elo:A, 5elo:B, 5elo:C, 5elo:D, 6hcw:A, 6hcw:B, 7zog:A, 7zog:B, 7zog:C, 7zog:D |