AYGDGPKKWGAVLLPLTIFGVGITAMGTFVLYTFSEDFFWAFVPGSKRSMELEKKKKEMAEKYPSPVVQHPADPLAGLVN
RADYEKGLEEAWDKVKPKGSTVTVEEKLKELSTQNNPHYWRNAIKS
The query sequence (length=126) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8jw0:i | 126 | 126 | 1.0000 | 1.0000 | 1.0000 | 3.18e-91 | |
2 | 8jjr:i | 120 | 123 | 0.5238 | 0.5500 | 0.5366 | 7.96e-40 | |
3 | 8jze:i | 119 | 122 | 0.5317 | 0.5630 | 0.5492 | 1.21e-39 | 8jzf:i |
4 | 5hiw:A | 391 | 51 | 0.1429 | 0.0460 | 0.3529 | 0.43 | |
5 | 5gan:B | 1781 | 53 | 0.1270 | 0.0090 | 0.3019 | 1.1 | 4bgd:A, 5gao:B, 5gap:B, 5nrl:B, 5zwm:D, 5zwo:D |
6 | 2glj:A | 456 | 65 | 0.1825 | 0.0504 | 0.3538 | 1.9 | 2glj:B, 2glj:C, 2glj:D, 2glj:E, 2glj:F, 2glj:G, 2glj:H, 2glj:I, 2glj:J, 2glj:K, 2glj:L, 2glj:M, 2glj:N, 2glj:O, 2glj:P, 2glj:Q, 2glj:R, 2glj:S, 2glj:T, 2glj:U, 2glj:V, 2glj:W, 2glj:X |
7 | 5zer:A | 354 | 50 | 0.1349 | 0.0480 | 0.3400 | 5.9 | 5zer:B, 5zes:A, 5zfk:A, 5zfk:B |
8 | 4xau:C | 374 | 58 | 0.1190 | 0.0401 | 0.2586 | 6.6 | |
9 | 4hln:A | 504 | 36 | 0.1032 | 0.0258 | 0.3611 | 7.9 | |
10 | 1tec:E | 279 | 50 | 0.1190 | 0.0538 | 0.3000 | 9.0 | 2tec:E, 3tec:E, 1thm:A |