BioLiP

>protein
AYEWGVRSTRKPEPPPLDRVYEIPGLEPITYAGKMHFMPGLARPVFPPWDPGWTHPKFRRLPPLHEHPLYKDQACYVFHQ
RCRLLEGVKQALWLTKTQLIEGLPEKVLRLADDPRNHIENQDERVLNAISHARLWHSTEDIPKRETYCPVIVDSLIQLCK
SQILKHPSLARRICAQNNTLSATWNRESILLQVHGSSGARLNAKDPLPPVASQEEVEATKNHVLETFYPISPTMGLQECN
VYDVNDDTGFQEGYPYPCPHTLYFLESANLRPRRFQPDQLRAKMILFAFGSALAQARLLYGNDSKVLEQPVVVQSVGTDG
RLFQFLVLQLNTTDLASDEGVKNLAWVDSDQLLYQHFWCLPVIKKKVVVEPVGPIGFQPETFRKFLALYLHGA

The query sequence (length=393) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5aj4:Ba	393	393	1.0000	1.0000	1.0000	0.0	6gaw:Ba, 6gb2:Ba, 7nqh:Ba, 7nql:Ba, 7nsh:Ba, 7nsi:Ba, 7nsj:Ba, 8oin:Bm, 8oiq:Bm, 6ydp:Ba, 6ydw:Ba
2	8any:5	394	393	0.8524	0.8503	0.8524	0.0	7a5f:53, 7a5g:53, 7a5h:5, 7a5i:53, 7a5j:5, 7a5k:53, 6i9r:5, 3j7y:5, 3j9m:5, 8k2a:Lk, 8k2b:Lk, 7l08:5, 7l20:5, 6nu2:5, 6nu3:5, 7o9k:5, 7o9m:5, 7odr:5, 7ods:5, 7odt:5, 7of0:5, 7of2:5, 7of3:5, 7of4:5, 7of5:5, 7of6:5, 7of7:5, 7og4:5, 7oi6:5, 7oi7:5, 7oi8:5, 7oi9:5, 7oia:5, 7oib:5, 7oic:5, 7oid:5, 7oie:5, 8oir:Bm, 8oit:Bm, 5ool:5, 5oom:5, 7pd3:5, 8pk0:5, 7po4:5, 7qh6:5, 7qh7:5, 7qi4:5, 7qi5:5, 7qi6:5, 8qsj:5, 8qu1:5, 8qu5:5, 6vlz:5, 6vmi:5, 8xt0:Lk, 8xt1:Lk, 8xt2:Lk, 8xt3:Lk, 6zm5:5, 6zm6:5, 6zs9:5, 6zsa:5, 6zsb:5, 6zsc:5, 6zsd:5, 6zse:5, 6zsg:5
3	7a5f:s3	370	113	0.0916	0.0973	0.3186	0.010	7a5g:s3, 7a5h:s, 7a5i:s3, 7a5j:s, 7a5k:s3, 6i9r:s, 3j7y:s, 3j9m:s, 8k2a:Sf, 8k2b:Sf, 6nu2:s, 6nu3:s, 7o9k:s, 7of0:s, 7of2:s, 7of3:s, 7of4:s, 7of5:s, 7of6:s, 7of7:s, 7og4:s, 7oi6:s, 7oi7:s, 7oi8:s, 7oi9:s, 7oia:s, 7oib:s, 7oic:s, 7oid:s, 7oie:s, 5ool:s, 5oom:s, 7pd3:s, 7qh6:s, 7qh7:s, 8qu5:s, 8xt0:Sf, 8xt1:Sf, 8xt2:Sf, 8xt3:Sf, 6zs9:s, 6zsa:s, 6zsb:s, 6zsc:s, 6zsd:s, 6zse:s, 6zsg:s
4	7l08:s	393	113	0.0916	0.0916	0.3186	0.010	8any:s, 7l20:s, 7o9m:s, 7odr:s, 7ods:s, 7odt:s, 8oir:Bi, 8oit:Bi, 8pk0:s, 7po4:s, 7qi4:s, 7qi5:s, 7qi6:s, 8qsj:s, 6vlz:s, 6vmi:s, 6zm5:s, 6zm6:s
5	5aj4:Bw	387	80	0.0662	0.0672	0.3250	0.015	6gaw:Bw, 6gb2:Bw, 7nqh:Bw, 7nql:Bw, 7nsh:Bw, 7nsi:Bw, 7nsj:Bw, 8oin:Bi, 8oiq:Bi, 6ydp:Bw, 6ydw:Bw
6	8f5o:B	1134	177	0.1069	0.0370	0.2373	0.18	8f5p:B
7	7mq8:LO	848	88	0.0509	0.0236	0.2273	2.7	7mq9:LO
8	7mqa:LO	819	88	0.0509	0.0244	0.2273	2.8
9	8urw:C	1080	103	0.0636	0.0231	0.2427	4.7	8syi:C

[Back]