BioLiP

>protein
AWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAA
LPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMCSEF

The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3b2d:C	139	139	1.0000	1.0000	1.0000	1.03e-102	3b2d:D
2	3t6q:C	139	139	0.7194	0.7194	0.7194	2.16e-79	3m7o:A, 3m7o:D, 3t6q:D
3	3rg1:C	138	135	0.7122	0.7174	0.7333	4.56e-78	3rg1:O, 3rg1:D, 3rg1:H, 3rg1:L, 3rg1:P
4	3mu3:A	140	133	0.4245	0.4214	0.4436	2.86e-42	3mu3:B
5	5ijd:C	137	130	0.2230	0.2263	0.2385	1.53e-05	5ijc:D, 5ijc:C, 5ijd:D, 7mlm:C, 3vq1:C, 3vq1:D, 3vq2:C, 3vq2:D
6	2e59:A	144	119	0.2014	0.1944	0.2353	7.80e-05	4g8a:C, 4g8a:D, 3ula:D, 3ula:B, 2z65:C, 2z65:D
7	7ye1:G	103	63	0.1295	0.1748	0.2857	0.15	7ye2:G, 5yiv:A, 5yiv:B, 5yiv:C, 5yiv:D, 5yiw:A, 5yiw:C, 5yix:B, 5z7i:A, 5z7i:C
8	2re1:A	148	26	0.0647	0.0608	0.3462	0.27
9	8y9b:B	1607	58	0.1367	0.0118	0.3276	4.2
10	5tf4:D	268	30	0.0791	0.0410	0.3667	4.7	5tf4:A, 5tf4:B, 5tf4:C, 5tf4:E, 5tf4:F
11	3jaj:z	426	36	0.0935	0.0305	0.3611	6.9	6frk:x, 3jan:z, 7obq:x, 6r6g:AB
12	7obr:x	488	36	0.0935	0.0266	0.3611	7.0	2go5:W, 2j37:W, 5l3q:A, 5l3q:C, 1mfq:C, 7nfx:x, 7qwq:x, 1ry1:W, 4ue5:D, 6y2z:A, 6y32:A, 6y32:C, 6y32:E, 6y32:G
13	3k31:A	262	27	0.0719	0.0382	0.3704	9.0
14	7w7g:B	1711	29	0.0863	0.0070	0.4138	9.3

[Back]