AWPTHTACRNGNLQVLYQSCDPLQDFGFSVDQCARQLKPNINIRFGMVLREDIEQLFLDVALFSKGLSILNFSYPVCEVD
LPKFSFCGRRKGEQIYYAGPINNPGFEIPEGDYQVLLELYNQDHATVACANATVLYSA
The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3rg1:C | 138 | 136 | 0.9855 | 0.9855 | 1.0000 | 5.07e-101 | 3rg1:O, 3rg1:D, 3rg1:H, 3rg1:L, 3rg1:P |
2 | 3b2d:C | 139 | 137 | 0.7246 | 0.7194 | 0.7299 | 2.03e-78 | 3b2d:D |
3 | 3t6q:C | 139 | 137 | 0.6957 | 0.6906 | 0.7007 | 6.03e-77 | 3m7o:A, 3m7o:D, 3t6q:D |
4 | 3mu3:A | 140 | 133 | 0.4565 | 0.4500 | 0.4737 | 4.94e-44 | 3mu3:B |
5 | 5ijd:C | 137 | 131 | 0.2029 | 0.2044 | 0.2137 | 3.87e-05 | 5ijc:D, 5ijc:C, 5ijd:D, 7mlm:C, 3vq1:C, 3vq1:D, 3vq2:C, 3vq2:D |
6 | 2e59:A | 144 | 119 | 0.1667 | 0.1597 | 0.1933 | 5.38e-04 | 4g8a:C, 4g8a:D, 3ula:D, 3ula:B, 2z65:C, 2z65:D |
7 | 1kgz:B | 330 | 41 | 0.1232 | 0.0515 | 0.4146 | 0.13 | 1kgz:A |
8 | 7ye1:G | 103 | 75 | 0.1449 | 0.1942 | 0.2667 | 0.70 | 7ye2:G, 5yiv:A, 5yiv:B, 5yiv:C, 5yiv:D, 5yiw:A, 5yiw:C, 5yix:B, 5z7i:A, 5z7i:C |
9 | 4o1e:A | 271 | 43 | 0.1159 | 0.0590 | 0.3721 | 1.5 | 4o1e:B, 4o1f:A, 4o1f:B |
10 | 6r4n:C | 147 | 146 | 0.2681 | 0.2517 | 0.2534 | 3.8 | 6r4n:A, 6r4n:E |