AWPTHTACRNGNLQVLYQSCDPLQDFGFSVDQCARQLKPNINIRFGMVLREDIEQLFLDVALFSKGLSILNFSYPVCEVD
LPKFSFCGRRKGEQIYYAGPINNPGFEIPEGDYQVLLELYNQDHATVACANATVLY
The query sequence (length=136) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3rg1:C | 138 | 136 | 1.0000 | 0.9855 | 1.0000 | 1.05e-100 | 3rg1:O, 3rg1:D, 3rg1:H, 3rg1:L, 3rg1:P |
2 | 3b2d:C | 139 | 135 | 0.7279 | 0.7122 | 0.7333 | 3.62e-78 | 3b2d:D |
3 | 3t6q:C | 139 | 134 | 0.6985 | 0.6835 | 0.7090 | 1.44e-76 | 3m7o:A, 3m7o:D, 3t6q:D |
4 | 3mu3:A | 140 | 133 | 0.4632 | 0.4500 | 0.4737 | 4.84e-44 | 3mu3:B |
5 | 5ijd:C | 137 | 131 | 0.2059 | 0.2044 | 0.2137 | 3.68e-05 | 5ijc:D, 5ijc:C, 5ijd:D, 7mlm:C, 3vq1:C, 3vq1:D, 3vq2:C, 3vq2:D |
6 | 2e59:A | 144 | 119 | 0.1691 | 0.1597 | 0.1933 | 4.55e-04 | 4g8a:C, 4g8a:D, 3ula:D, 3ula:B, 2z65:C, 2z65:D |
7 | 1kgz:B | 330 | 41 | 0.1250 | 0.0515 | 0.4146 | 0.12 | 1kgz:A |
8 | 7ye1:G | 103 | 75 | 0.1471 | 0.1942 | 0.2667 | 0.65 | 7ye2:G, 5yiv:A, 5yiv:B, 5yiv:C, 5yiv:D, 5yiw:A, 5yiw:C, 5yix:B, 5z7i:A, 5z7i:C |
9 | 4o1e:A | 271 | 43 | 0.1176 | 0.0590 | 0.3721 | 1.5 | 4o1e:B, 4o1f:A, 4o1f:B |
10 | 6r4n:C | 147 | 146 | 0.2721 | 0.2517 | 0.2534 | 3.7 | 6r4n:A, 6r4n:E |
11 | 1qvi:A | 806 | 73 | 0.1471 | 0.0248 | 0.2740 | 9.8 | 1kk7:A, 1kk8:A, 2otg:A, 1s5g:A |