BioLiP

>protein
AVYNIGWSFNVNGARGKSFRAGDVLVFKYIKGQHNVVAVNGRGYASCSAPRGARTYSSGQDRIKLTRGQNYFICSFPGHC
GGGMKIAINAK

The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1f56:A	91	91	1.0000	1.0000	1.0000	3.30e-63	1f56:B, 1f56:C
2	2cbp:A	96	86	0.5495	0.5208	0.5814	2.26e-34
3	1ws7:A	107	76	0.3516	0.2991	0.4211	2.54e-15	1ws7:B, 1ws7:C, 1ws7:D, 1ws8:A, 1ws8:B, 1ws8:C, 1ws8:D
4	1x9r:A	105	83	0.3077	0.2667	0.3373	4.68e-12	1x9r:B, 1x9u:A, 1x9u:B
5	1jer:A	110	96	0.3297	0.2727	0.3125	3.43e-08
6	2h3x:C	128	45	0.2198	0.1562	0.4444	0.011	2h3x:F, 2h47:C, 2iaa:C
7	6l1v:A	129	41	0.1868	0.1318	0.4146	0.077	6l1v:C, 6l1v:E, 6l1v:G, 1rkr:A, 1rkr:B, 1rkr:C, 1rkr:D
8	1a4a:A	129	49	0.2088	0.1473	0.3878	0.46	1a4a:B, 1a4b:A, 1a4b:B, 1a4c:A, 1a4c:B, 1a4c:C, 1a4c:D, 1azb:A, 1azb:B, 1azc:A, 1azc:B, 2aza:A, 2aza:B, 1uri:A, 1uri:B
9	2ccw:A	129	48	0.1978	0.1395	0.3750	0.48	1dyz:A, 1dz0:A
10	6kol:A	125	30	0.1319	0.0960	0.4000	0.57	6l9s:A
11	1dlw:A	116	53	0.1758	0.1379	0.3019	0.88	1uvy:A
12	1nwo:A	128	20	0.1319	0.0938	0.6000	0.89	1nwo:B, 1nwp:A, 1nwp:B
13	1joi:A	128	20	0.1319	0.0938	0.6000	0.92
14	2n0m:A	130	28	0.1319	0.0923	0.4286	0.94	3ay2:A, 3ay2:B
15	1ov8:A	139	18	0.1099	0.0719	0.5556	0.98	1ov8:B, 1ov8:C, 1ov8:D, 1qhq:A
16	6tfo:C	424	67	0.2418	0.0519	0.3284	1.1	6tfd:A, 6tfd:C, 6tfd:B, 6tfo:A, 6tfo:B
17	5syd:B	131	20	0.1209	0.0840	0.5500	1.2	5syd:A
18	1cur:A	155	19	0.0989	0.0581	0.4737	1.6	1a3z:A, 1a8z:A, 2cak:A, 2cal:A, 1e30:A, 1e30:B, 1gy1:A, 1gy1:B, 1gy2:A, 1gy2:B, 1rcy:A
19	6grd:A	407	55	0.1648	0.0369	0.2727	2.9	5cnq:A, 5co8:C, 5co8:A, 6grb:A, 6grc:A
20	2e22:A	752	17	0.1209	0.0146	0.6471	4.0	1j0m:A, 1j0n:A, 1x1i:A, 1x1j:A

[Back]