BioLiP

>protein
AVRGFLIVGNKAFTQPFSLNDLPGAGRMDVLCRCTSQALFISHGIRRDVEVYLLLLGPPSPPKSILIKGDEVRRMSPDER
NVAGHIKKALAVECGKSWKKVHSGVYVSRKGLEELIEELSEKYSIIYLKEDGVDISNAQLPPNPLFVIGDHEGLTEEQEK
VVERYAALKLSLSPLSLLAEQCVVIAHHHLDRLQF

The query sequence (length=195) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2qmm:A	195	195	1.0000	1.0000	1.0000	1.10e-143	2qmm:B
2	3ai9:X	211	201	0.4564	0.4218	0.4428	1.06e-51	3aia:A, 3aia:B
3	4ds1:A	86	20	0.0513	0.1163	0.5000	1.00	4ds1:C, 4ht6:A, 4ht6:C, 4ht6:E
4	3ufx:B	378	74	0.1231	0.0635	0.3243	1.5	3ufx:E, 3ufx:G, 3ufx:I
5	3vsh:D	304	33	0.0667	0.0428	0.3939	1.7	3vsh:B, 3vsi:B, 3vsi:D, 3vsj:B, 3vsj:D
6	5o96:D	243	46	0.0718	0.0576	0.3043	1.9	5o96:A, 5o96:B, 5o96:C, 5o96:E, 5o96:F, 5o96:G, 5o96:H
7	8c6z:A	573	26	0.0513	0.0175	0.3846	3.4	8ovr:A
8	5hh9:A	390	93	0.1487	0.0744	0.3118	3.9	5hh9:B, 5i90:A, 5i90:B
9	4xww:A	545	57	0.0872	0.0312	0.2982	4.2	4xwt:A, 4xwt:B, 4xww:B
10	2wyh:A	905	49	0.0821	0.0177	0.3265	5.4	2wyh:B, 2wyi:A, 2wyi:B
11	4r78:A	287	28	0.0667	0.0453	0.4643	7.8	4r7b:A, 4r7b:B
12	5fjy:A	267	34	0.0564	0.0412	0.3235	7.9	6f9i:A, 6f9i:B, 5fjy:B, 3zfw:A, 3zfw:B
13	7e0d:A	604	52	0.1026	0.0331	0.3846	7.9	7e0c:A, 2e1m:A, 2e1m:B, 2e1m:C, 8jpw:A
14	1pl6:A	356	62	0.0769	0.0421	0.2419	8.6	1pl6:B, 1pl6:C, 1pl6:D, 1pl7:A, 1pl7:B, 1pl7:C, 1pl7:D, 1pl8:A, 1pl8:B, 1pl8:C, 1pl8:D

[Back]