AVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKA
FHD
The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8hib:A | 83 | 83 | 1.0000 | 1.0000 | 1.0000 | 4.05e-59 | 8hib:B |
2 | 5w1h:A | 1301 | 27 | 0.1446 | 0.0092 | 0.4444 | 1.4 | 5w1i:A, 5w1i:C, 5wlh:A |
3 | 7dvr:A | 147 | 29 | 0.1566 | 0.0884 | 0.4483 | 6.0 | 7dvt:A, 7dvu:A, 7dvv:A, 7dvv:B |
4 | 1tq6:A | 402 | 39 | 0.1566 | 0.0323 | 0.3333 | 7.7 | 5fph:A, 5fph:B, 5fph:C, 5fph:D, 5fph:E, 5fph:F, 5fph:G, 4lv5:B, 4lv8:B, 1tpz:A, 1tpz:B, 1tq2:A, 1tq2:B, 1tq4:A |